PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla008252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family WOX
Protein Properties Length: 213aa    MW: 23943.6 Da    PI: 9.9163
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla008252genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.91.3e-211069357
               --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
               +R+++tkeq+ +Le+l+++  r+psa+++++++++l    +++ ++V++WFqN++a++++
  Cla008252 10 SRWNPTKEQISILENLYRQgVRTPSADQIQQITSRLkaygHIEGKNVFYWFQNHKARQRQ 69
               7*****************99**************************************97 PP

2Wus_type_Homeobox118.72.6e-38871265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++RW+Pt+eQi iLe+ly++G+rtP++++iq+it++L++yG+ie+kNVfyWFQN+kaR+rqkq
          Cla008252  8 VSSRWNPTKEQISILENLYRQGVRTPSADQIQQITSRLKAYGHIEGKNVFYWFQNHKARQRQKQ 71
                       579***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.884570IPR001356Homeobox domain
SMARTSM003892.3E-6774IPR001356Homeobox domain
SuperFamilySSF466891.92E-13976IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-91069IPR009057Homeodomain-like
PfamPF000463.2E-191069IPR001356Homeobox domain
CDDcd000868.39E-71171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MGGGGPPVSS RWNPTKEQIS ILENLYRQGV RTPSADQIQQ ITSRLKAYGH IEGKNVFYWF  60
QNHKARQRQK QKQHSTFPLF NHFLHFNPNS PFPPPSVVCS PYYVHQNDVG LYQQYQNNSM  120
VIQTGGIVKR RSKSERRNCN NNNNININEE SAINNNLSFQ STETLPLFPT HPTGDLQAGL  180
ASPSQPMAPG SASSGNSADD SAGGRRPYFE FFM
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in embryonic patterning. Required for apical embryo development after fertilization. Its specific localization to the apical daughter cell of the zygote, while WOX8 is confined to the basal cell, suggests that the asymmetric division of the plant zygote separates determinants of apical and basal cell fates. {ECO:0000269|PubMed:14711878}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819263e-82LN681926.1 Cucumis melo genomic scaffold, anchoredscaffold00044.
GenBankLN7132663e-82LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150189.23e-94PREDICTED: WUSCHEL-related homeobox 2
SwissprotQ6X7K12e-49WOX2_ARATH; WUSCHEL-related homeobox 2
TrEMBLA0A0A0LVA98e-93A0A0A0LVA9_CUCSA; Uncharacterized protein
STRINGXP_004150189.19e-94(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.15e-33WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  2. Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
    WUSCHEL-RELATED HOMEOBOX 2 is important for protoderm and suspensor development in the gymnosperm Norway spruce.
    BMC Plant Biol., 2016. 16: p. 19
    [PMID:26786587]
  3. Zhang Z,Tucker E,Hermann M,Laux T
    A Molecular Framework for the Embryonic Initiation of Shoot Meristem Stem Cells.
    Dev. Cell, 2017. 40(3): p. 264-277.e4
    [PMID:28171749]