PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla007823
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family M-type_MADS
Protein Properties Length: 345aa    MW: 40030.3 Da    PI: 6.5109
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla007823genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF56.63.2e-181053245
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                i+n+  r++tf kR++ +l KA+ELS+LCd++ +v +++++++
  Cla007823 10 LINNEKSRKTTFYKRKASLLRKAYELSTLCDVRTCVFVYGPNQN 53
               699**************************************984 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-16160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.909151IPR002100Transcription factor, MADS-box
CDDcd001202.84E-21265No hitNo description
SuperFamilySSF554551.57E-202100IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-161152IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-92338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRGKLSMKL INNEKSRKTT FYKRKASLLR KAYELSTLCD VRTCVFVYGP NQNDQSPLQL  60
HTWPSCREDI NEMIASYKAN CLHKRARKAF GLLDFFSERK KKIETDMSKL RKDVAEARFP  120
KWDERLDHLL EDQLRVLMVE LDSKLEMTKR RIETVTENVE EGTSVESSQT LNGNMKQKQI  180
MAFDEGEESY GMFGRSSMEQ TQAIMPFHHQ YHQLQTMAQS LQMDQELENL SPFLFGGNGS  240
SPQIQLSYGN TNCFQNYPHN FYNDPTINGM VMDNTQSYSM CHYGLPLTTQ SVLPLSYMQM  300
QLTDDQLMMA CASNSQMALP NNASTQVNDQ FDYFNYEYFI KPNNF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008460878.10.0PREDICTED: MADS-box protein SOC1-like
TrEMBLA0A1S3CDG60.0A0A1S3CDG6_CUCME; MADS-box protein SOC1-like
STRINGXP_008460878.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.14e-22M-type_MADS family protein