PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla007701
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family GRAS
Protein Properties Length: 437aa    MW: 48980.7 Da    PI: 6.1826
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla007701genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS285.31.8e-87454282373
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalkl..fsevsPilkfshl 96 
                ++lL++cA a++s+d +laq++++ l++ asp gdp+qRl++ f++AL  r +r ++    + +  + + +n   +s+ ++++ l  +++v P+++f++ 
  Cla007701  45 EKLLVHCASALESHDVTLAQQVMWVLNNVASPVGDPNQRLTSWFLRALIFRASRVSPAPTPTPTLMNFNGSNtcvESRLMSVTDLarYVDVIPWYRFGFC 144
                689*********************************************999999544444433333443333442444455555599************* PP

       GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl..vakrledl.. 189
                +aN aI++a+++ ++vHi+Df+is+++QWp+L++aL++Rp+gpps+Ri + +   ++    +  ++++g  L+kfA++ ++pf+fn++   +++ +++  
  Cla007701 145 AANIAIYKAIQRYQKVHILDFSISHCMQWPTLIDALSKRPQGPPSVRISVPSFRPPVpplLNIPTHQIGLCLTKFANSKNIPFQFNLFpyNHNNSNNIff 244
                *************************************************988766667789999***********************9874444444445 PP

       GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                ++++L ++++Eal++n+++ l ++ +++ +++    +d+++k+ ksl+P+++vvv+++++++++s++ r++ +++y++  fd+le+ l +es +r  +E+
  Cla007701 245 DPSNLTLQENEALVINCQHWLRYISNDDDDVDClsSKDNFIKATKSLNPRIIVVVDEDSNMTDSSLASRITTCFNYFWIPFDALETFLTKESAQRLEYEA 344
                ************************977655543339**************************************************************** PP

       GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  +g++i+n++  eg++r+er e   k +er+++ G+ ++p+ +++a+++k+ll++ +  g+ ++ e+++lvl+Wk+++ v+v+aW
  Cla007701 345 D-VGQRIENIIGFEGNQRVERLEGCVKVSERMRDGGYLNAPFCDDVADEVKALLAEQA-SGWGMKREEDALVLTWKGHNSVFVTAW 428
                *.9*****************************************************99.88999999******************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.68918410IPR005202Transcription factor GRAS
PfamPF035146.1E-8545428IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MRAELREKTS SISVHNSTIL NRAHNSSLSG ALKGCLGSLD GGCIEKLLVH CASALESHDV  60
TLAQQVMWVL NNVASPVGDP NQRLTSWFLR ALIFRASRVS PAPTPTPTLM NFNGSNTCVE  120
SRLMSVTDLA RYVDVIPWYR FGFCAANIAI YKAIQRYQKV HILDFSISHC MQWPTLIDAL  180
SKRPQGPPSV RISVPSFRPP VPPLLNIPTH QIGLCLTKFA NSKNIPFQFN LFPYNHNNSN  240
NIFFDPSNLT LQENEALVIN CQHWLRYISN DDDDVDCLSS KDNFIKATKS LNPRIIVVVD  300
EDSNMTDSSL ASRITTCFNY FWIPFDALET FLTKESAQRL EYEADVGQRI ENIIGFEGNQ  360
RVERLEGCVK VSERMRDGGY LNAPFCDDVA DEVKALLAEQ ASGWGMKREE DALVLTWKGH  420
NSVFVTAWVT NDEIGVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-27444284374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132551e-152LN713255.1 Cucumis melo genomic chromosome, chr_1.
GenBankLN6817921e-152LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004144576.10.0PREDICTED: scarecrow-like protein 32
TrEMBLA0A0A0K3M70.0A0A0A0K3M7_CUCSA; Uncharacterized protein
STRINGGLYMA13G38080.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100743142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-114GRAS family protein