PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla007276
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 214aa    MW: 23317.4 Da    PI: 8.2417
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla007276genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.61.6e-41191181100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l +++e++r da++slvyeA++r+rdPvyG++g i++lq+q++ l+ael+++++e
  Cla007276  19 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVSENQRADAANSLVYEANVRLRDPVYGCMGAISALQHQIQALQAELNAVRAE 118
                7***********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.72818119IPR004883Lateral organ boundaries, LOB
PfamPF031959.8E-4219116IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MGRRTSLQAP PGTLNTITPC AACKLLRRRC AQECPFSPYF SPHEPHKFAS VHKVFGASNV  60
SKMLMEVSEN QRADAANSLV YEANVRLRDP VYGCMGAISA LQHQIQALQA ELNAVRAEIL  120
RHKFREANNM IHSSPQQQHL PFLSSSTEVV SVAVPPPPPP PPLPPPPHHD ASSSTSSLYN  180
RPVVAVAADY STISSDENVP YFVTTSSTAH QLNS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132641e-159LN713264.1 Cucumis melo genomic chromosome, chr_10.
GenBankLN6819001e-159LN681900.1 Cucumis melo genomic scaffold, anchoredscaffold00041.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008456927.11e-121PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT611e-75LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0A0KM941e-120A0A0A0KM94_CUCSA; Uncharacterized protein
STRINGPOPTR_0013s08040.12e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-76LOB domain-containing protein 13