PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla007240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 166aa    MW: 18163.9 Da    PI: 6.873
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla007240genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.74.8e-4461051100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+ slvyeA ar+rdPvyG+vg i+ lq+q++ql+ +la++++e
  Cla007240   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVQQRGDAVMSLVYEASARVRDPVYGCVGAISYLQNQVSQLQMQLAVAQAE 105
                7***********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6915106IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPVQQRG  60
DAVMSLVYEA SARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQQDNPVFPN  120
CPQIHSDDKP SSLLLPPPSP PPSQCLNFAS SPNVIYDTIF GHDIVS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132641e-143LN713264.1 Cucumis melo genomic chromosome, chr_10.
GenBankLN6819051e-143LN681905.1 Cucumis melo genomic scaffold, anchoredscaffold00033.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148190.11e-105PREDICTED: LOB domain-containing protein 12-like
RefseqXP_008454827.11e-105PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-71LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0A0KP741e-105A0A0A0KP74_CUCSA; Uncharacterized protein
STRINGGLYMA18G02780.11e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-72LBD family protein