PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla006623
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 136aa    MW: 14757.6 Da    PI: 6.5023
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla006623genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26056.39.3e-1815745101
     DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                +++++pe++r da++slvyeA+ r+rdPvyG++gvi++lq+ql++l+++l+++++++
  Cla006623   1 MYDEVPESQRADAANSLVYEANLRLRDPVYGCMGVISALQHQLHTLQSDLNSIRTQI 57 
                57899**********************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.262157IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-15354IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MYDEVPESQR ADAANSLVYE ANLRLRDPVY GCMGVISALQ HQLHTLQSDL NSIRTQIFNF  60
KFTQHNNSHI PNFISAAATP PAAPPTPPHS QPPPLSLPPP LPSSSSIFSS PIITTTTAAP  120
ELINPISTTQ HISYFG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132576e-67LN713257.1 Cucumis melo genomic chromosome, chr_3.
GenBankLN6818216e-67LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008456762.18e-38PREDICTED: LOB domain-containing protein 15-like
TrEMBLA0A0A0K8P65e-37A0A0A0K8P6_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.13e-26LOB domain-containing protein 13