PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla006329
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family GRAS
Protein Properties Length: 471aa    MW: 52951.9 Da    PI: 6.2444
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla006329genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS472.91.8e-144464681374
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l++lLl+cA++v+ g+l  a+ +L ++s+las dgd+mqR+aayf+eALa r+++++++lyka+++++ +   +se++ + klf+e++P+lk++++++Nq
  Cla006329  46 LIHLLLTCANHVAVGSLDSANLALDQISHLASADGDTMQRIAAYFAEALADRILKTWPGLYKAFNSTKIP--MVSEKILVKKLFFEMFPFLKVAFVLTNQ 143
                689*************************************************************999998..69************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
                aI+ea+ege+++HiiD+++++ +QW+aLlq L+ Rpegpp+lRiTgv++    +ke l ++++rL++ Ae+l++pf+fn  v +rl+dl++e+Lrvk+gE
  Cla006329 144 AIVEAMEGEKMIHIIDLNANETAQWLALLQVLSVRPEGPPHLRITGVHP----QKEVLDQMARRLTDEAEKLDIPFQFNS-VISRLDDLDMEKLRVKTGE 238
                *************************************************....9**************************.79***************** PP

       GRAS 201 alaVnlvlqlhrll........................................................desvsleserdevLklvkslsPkvvvvveq 244
                ala+n+vlqlh+ll                                                        + s++   ++d++L+ ++sl Pkv+vv+eq
  Cla006329 239 ALAINSVLQLHTLLgcdnevlqkpspsaaksangvqysryphlnqttlsdlldkdlvngcspspdsvsssALSQANVTKIDSFLNGLWSLTPKVMVVTEQ 338
                ******************************************************************996633333333799******************* PP

       GRAS 245 eadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                +++hn+++++er+leal++y+a+fd+le++++r+s er k+E++l+g+ei+n++acegaer+erhe+ ekW++r++ aGF+ v+ls++ ++qa++ll+ +
  Cla006329 339 DSNHNGSTLMERLLEALHTYAAIFDCLESNMSRTSLERLKLEKMLFGEEIKNIIACEGAERKERHEKQEKWSQRFDVAGFRHVSLSYYGMMQARSLLQGY 438
                **************************************************************************************************** PP

       GRAS 345 ksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                + dgyr++ee+g+++++W+drpL+svSaWr
  Cla006329 439 GCDGYRMKEENGCVMICWQDRPLFSVSAWR 468
                *****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.1620448IPR005202Transcription factor GRAS
PfamPF035146.1E-14246468IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MFQDEGTSSI TSSPLQFFTM MSLSPKLGSP YPWLRELKSE ERGLYLIHLL LTCANHVAVG  60
SLDSANLALD QISHLASADG DTMQRIAAYF AEALADRILK TWPGLYKAFN STKIPMVSEK  120
ILVKKLFFEM FPFLKVAFVL TNQAIVEAME GEKMIHIIDL NANETAQWLA LLQVLSVRPE  180
GPPHLRITGV HPQKEVLDQM ARRLTDEAEK LDIPFQFNSV ISRLDDLDME KLRVKTGEAL  240
AINSVLQLHT LLGCDNEVLQ KPSPSAAKSA NGVQYSRYPH LNQTTLSDLL DKDLVNGCSP  300
SPDSVSSSAL SQANVTKIDS FLNGLWSLTP KVMVVTEQDS NHNGSTLMER LLEALHTYAA  360
IFDCLESNMS RTSLERLKLE KMLFGEEIKN IIACEGAERK ERHEKQEKWS QRFDVAGFRH  420
VSLSYYGMMQ ARSLLQGYGC DGYRMKEENG CVMICWQDRP LFSVSAWRCC K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-40464684375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
GenBankLN6818070.0LN681807.1 Cucumis melo genomic scaffold, anchoredscaffold00024.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008450378.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A0A0LXG00.0A0A0A0LXG0_CUCSA; Uncharacterized protein
STRINGPOPTR_0009s05330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23833484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3