PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla006268
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 334aa    MW: 39080.6 Da    PI: 6.134
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla006268genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1791.3e-5571361129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPtdeelv++yL+kk+ ++++el +vik+vd+yk+ePwdL++  ++ + +++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s k+
  Cla006268   7 VPPGFRFHPTDEELVDYYLRKKICSRRIEL-DVIKDVDLYKIEPWDLQEicSLGTeDQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYS-KH 104
                69****************************.9***************954533332566**************************************.88 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                 l+g++ktLvfykgrap+g+k+dW+mheyrle
  Cla006268 105 DLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                99****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-615156IPR003441NAC domain
PROSITE profilePS5100559.9457156IPR003441NAC domain
PfamPF023651.5E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MNTFLQVPPG FRFHPTDEEL VDYYLRKKIC SRRIELDVIK DVDLYKIEPW DLQEICSLGT  60
EDQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN ATPQEEGWVV CRVFKKRIAT VRRMNEHESP CWYEEPVSSF  180
MPDLDSPNQS SHSNFPHHIS NFPCKKEVDY LPYQQAQVPQ DHHFLHLPLL EGQKLANTFA  240
LDINLQASNF QPSAAKQQNI QQQFSDQNLL FLFDNNNNSN NEQTMDQLTD WRVFDKYVAS  300
QLSQENNNNA SKQEVIAPEN APTSTSTCQI ELWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-51515713169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818480.0LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008439092.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_008439093.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-128NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A1S3AXZ40.0A0A1S3AXZ4_CUCME; NAC domain-containing protein 7-like
STRINGXP_008439092.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-114NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]