PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 289aa    MW: 32919.2 Da    PI: 6.3437
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005970genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM130.31.4e-40101261129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgel 99 
                lppGfrF P+deelv++yL kk+ ++++    ++ e+d++++ePw+Lp     +       s rd+kyatg r+nrat+ gyWkatgkd++v++  +ge 
  Cla005970  10 LPPGFRFYPSDEELVCHYLYKKIMNEQVLK-GTLVEIDLHTCEPWQLP-----G-------SFRDRKYATGFRTNRATTCGYWKATGKDRTVVDPsTGEI 96 
                79************************9655.78***************.....2.......4699****************************9978899 PP

        NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                vg++ktLvfy++rap+g kt W+mhe+rle
  Cla005970  97 VGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 126
                ***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-528144IPR003441NAC domain
PROSITE profilePS5100547.01710144IPR003441NAC domain
PfamPF023659.3E-2411125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGLKDIGASL PPGFRFYPSD EELVCHYLYK KIMNEQVLKG TLVEIDLHTC EPWQLPGSFR  60
DRKYATGFRT NRATTCGYWK ATGKDRTVVD PSTGEIVGMR KTLVFYRNRA PNGIKTGWIM  120
HEFRLEAPHR PPKEDWVLCR VFQKGKQEEY NTKLINQHFT FGNFERVPSV VIRAPSPPPT  180
DPSQIAAMPC DYNVDIDIAS LSSSSMAPHQ ISHSHIGSCS FLHLLQLPQE KNDNNNTNPK  240
TDQLFCPKNN ESDYGVLWDM DLEEHTFQEG VSSNLDQMAF DVDSSLVFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-39914416165NO APICAL MERISTEM PROTEIN
1ut4_B2e-39914416165NO APICAL MERISTEM PROTEIN
1ut7_A2e-39914416165NO APICAL MERISTEM PROTEIN
1ut7_B2e-39914416165NO APICAL MERISTEM PROTEIN
3swm_A2e-39914419168NAC domain-containing protein 19
3swm_B2e-39914419168NAC domain-containing protein 19
3swm_C2e-39914419168NAC domain-containing protein 19
3swm_D2e-39914419168NAC domain-containing protein 19
3swp_A2e-39914419168NAC domain-containing protein 19
3swp_B2e-39914419168NAC domain-containing protein 19
3swp_C2e-39914419168NAC domain-containing protein 19
3swp_D2e-39914419168NAC domain-containing protein 19
4dul_A2e-39914416165NAC domain-containing protein 19
4dul_B2e-39914416165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818273e-83LN681827.1 Cucumis melo genomic scaffold, anchoredscaffold00018.
GenBankLN7132583e-83LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004152054.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A0A0LB560.0A0A0A0LB56_CUCSA; Uncharacterized protein
STRINGXP_004152054.10.0(Cucumis sativus)
STRINGXP_004169258.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43813359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-78NAC domain containing protein 74