PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005759
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 218aa    MW: 24218.2 Da    PI: 8.3021
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005759genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.61.4e-4591081100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql++l+ +l  +k+e
  Cla005759   9 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPHQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLCKLQMDLTCAKSE 108
                7*********************************************************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.1168109IPR004883Lateral organ boundaries, LOB
PfamPF031957.6E-459106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MASTSSNSPC AACKFLRRKC QPECVFAPYF PPDQPQKFAN VHKVFGASNV TKLLNELHPH  60
QREDAVNSLA YEADMRLRDP VYGCVGVISL LQHQLCKLQM DLTCAKSELS KYQNLGIGNH  120
AALISPPSTV STVAHGQRNH QPAFNFARDQ PHSLYHDQSF PRDQQQQQMM LRRSFDGGSN  180
YDGLLAVNVT ASIGNLSHQF QQPRAAAGDD RRGTLDHS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
GenBankLN6818460.0LN681846.1 Cucumis melo genomic scaffold, anchoredscaffold00009.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004152887.11e-157PREDICTED: LOB domain-containing protein 6
RefseqXP_011648980.11e-157PREDICTED: LOB domain-containing protein 6
SwissprotO044793e-81LBD6_ARATH; LOB domain-containing protein 6
TrEMBLA0A0A0LML71e-157A0A0A0LML7_CUCSA; Uncharacterized protein
STRINGVIT_00s0340g00090.t016e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96253043
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.49e-81LBD family protein