PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005712
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family M-type_MADS
Protein Properties Length: 78aa    MW: 8593.04 Da    PI: 10.6217
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005712genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.57.1e-181151343
               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
     SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
               i n   r  tf kR+n ++KKA+ELS+LCd++ +v+i ++ 
  Cla005712 11 IPNRKSRISTFKKRKNSLMKKAYELSTLCDVRTCVLIHGPA 51
               77899999*****************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.62E-19159IPR002100Transcription factor, MADS-box
SMARTSM004324.9E-17160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.586147IPR002100Transcription factor, MADS-box
CDDcd001205.28E-20260No hitNo description
PRINTSPR004041.2E-12323IPR002100Transcription factor, MADS-box
PfamPF003195.4E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MGRGKLSLNL IPNRKSRIST FKKRKNSLMK KAYELSTLCD VRTCVLIHGP ASSSTEDPST  60
QSELEFTLGL PIAPTSKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022935361.11e-25agamous-like MADS-box protein AGL14
RefseqXP_022983430.11e-25agamous-like MADS-box protein AGL14
TrEMBLA0A0A0LME61e-18A0A0A0LME6_CUCSA; Uncharacterized protein
TrEMBLA0A1S3CDG61e-18A0A1S3CDG6_CUCME; MADS-box protein SOC1-like
STRINGXP_008460878.12e-19(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-14M-type_MADS family protein