PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005508
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 325aa    MW: 36950.3 Da    PI: 8.3176
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005508genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.24.5e-51201483128
        NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...kge 98 
                pGfrFhPtdeelv++yL++kve+++++l e ik++diyk++PwdLp  + k ++kewyf++kr +ky+++ r+nr+t sg+Wkatg dk+v+s+   ++e
  Cla005508  20 PGFRFHPTDEELVSFYLRRKVEKRPISL-ELIKQIDIYKHNPWDLPyGSSKVGDKEWYFYCKRGRKYKNSIRPNRVTGSGFWKATGIDKPVYSNggeGNE 118
                9***************************.99***************66777899***************************************9766666 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 +glkktLv+y+g+a kg+ktdW+mhe+rl
  Cla005508 119 CIGLKKTLVYYRGSAGKGSKTDWMMHEFRL 148
                7***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.94118183IPR003441NAC domain
SuperFamilySSF1019418.76E-5519183IPR003441NAC domain
PfamPF023651.9E-2520148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
METPEVCNGG DGDDDQIPLP GFRFHPTDEE LVSFYLRRKV EKRPISLELI KQIDIYKHNP  60
WDLPYGSSKV GDKEWYFYCK RGRKYKNSIR PNRVTGSGFW KATGIDKPVY SNGGEGNECI  120
GLKKTLVYYR GSAGKGSKTD WMMHEFRLPP PNPTNNPKLL IQPNSKNFAQ EAEIWTLCRI  180
FKRNVSGRRY GSSGNWNNKQ AASTAATTTT TIKNPTTVEK NSEIMVGGAE KGNNNGEISY  240
INFSCESMII QTEKKPLLLD PNYLSNYNNH QQEWNNNSNY DQYSSCSSSG IISPPIAYPT  300
NQLVDVNDFF TNSNWDELRS MVDML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-482018919171NO APICAL MERISTEM PROTEIN
1ut4_B1e-482018919171NO APICAL MERISTEM PROTEIN
1ut7_A1e-482018919171NO APICAL MERISTEM PROTEIN
1ut7_B1e-482018919171NO APICAL MERISTEM PROTEIN
3swm_A1e-482018922174NAC domain-containing protein 19
3swm_B1e-482018922174NAC domain-containing protein 19
3swm_C1e-482018922174NAC domain-containing protein 19
3swm_D1e-482018922174NAC domain-containing protein 19
3swp_A1e-482018922174NAC domain-containing protein 19
3swp_B1e-482018922174NAC domain-containing protein 19
3swp_C1e-482018922174NAC domain-containing protein 19
3swp_D1e-482018922174NAC domain-containing protein 19
4dul_A1e-482018919171NAC domain-containing protein 19
4dul_B1e-482018919171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6895462e-90LN689546.1 Cucumis melo genomic scaffold, unassembled_sequence36985.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004139890.21e-160PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLA0A0A0K4181e-159A0A0A0K418_CUCSA; Uncharacterized protein
STRINGXP_004159185.11e-160(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.14e-81NAC domain containing protein 42