PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005507
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 156aa    MW: 16830.3 Da    PI: 8.0476
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005507genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601461e-45171171101
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca+dCv+apyfp++qp+kf  vhk+FGasnv+kll++lpe++r+da+ss+vyeA+ar+rdPvyG+vg+i+ lq++++ l+++la+++++
  Cla005507  17 PCAACKLLRRRCAPDCVFAPYFPSDQPHKFSSVHKVFGASNVSKLLQELPEHQRSDAVSSMVYEANARIRDPVYGCVGTISCLQREVDALQQQLAMTQAQ 116
                7***********************************************************************************************9988 PP

     DUF260 101 l 101
                l
  Cla005507 117 L 117
                5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0416117IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-4517114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MAASEMMMKK GGSGPPPCAA CKLLRRRCAP DCVFAPYFPS DQPHKFSSVH KVFGASNVSK  60
LLQELPEHQR SDAVSSMVYE ANARIRDPVY GCVGTISCLQ REVDALQQQL AMTQAQLVQL  120
KMGQFASTSQ ASSSTDDLLP PPPNINVGAS PSLWSC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132551e-86LN713255.1 Cucumis melo genomic chromosome, chr_1.
GenBankLN6818001e-86LN681800.1 Cucumis melo genomic scaffold, anchoredscaffold00017.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004139827.11e-77PREDICTED: LOB domain-containing protein 4-like
SwissprotQ8LBW33e-57LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0A0K5P41e-77A0A0A0K5P4_CUCSA; Uncharacterized protein
STRINGVIT_19s0027g01120.t012e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-52LBD family protein