PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005472
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 320aa    MW: 36920.5 Da    PI: 7.8939
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005472genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.31.5e-53111431129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.. 95 
                +ppGfrFhPtdeel+ +yL+kkv+ + +el +vi+evd++k+ePwdL+ k ++ + +++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++   
  Cla005472  11 VPPGFRFHPTDEELLYYYLRKKVSYEAIEL-DVIREVDLNKLEPWDLKdKcRIGSgHQNEWYFFSHKDKKYPTGTRTNRATSAGFWKATGRDKTIHTGnc 109
                69****************************.9***************843444443666*************************************9888 PP

        NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                +++ +g++ktLvfy+grap+g+ktdW+mheyrle
  Cla005472 110 NSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLE 143
                8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-595162IPR003441NAC domain
PROSITE profilePS5100558.75611162IPR003441NAC domain
PfamPF023652.9E-2812142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MMPENGQQLS VPPGFRFHPT DEELLYYYLR KKVSYEAIEL DVIREVDLNK LEPWDLKDKC  60
RIGSGHQNEW YFFSHKDKKY PTGTRTNRAT SAGFWKATGR DKTIHTGNCN SKRIGMRKTL  120
VFYTGRAPHG QKTDWIMHEY RLEDDNPELH EDGWVVCRVF KKKSHKPEVP QEQQLDYYTH  180
TKLGSSSASV MGAEMGEPKN NNNHMQEPYN NDYSFDGCMQ LPQLFSPESS VATPISLNAA  240
ATVECPQNIW RLSCGLVQHE RLNTDWSFLN RLLALDQQSR SKSTLSDDLT MGHSNSRKFS  300
FPFPYPYPLA SGADFIKFSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-52816414167NO APICAL MERISTEM PROTEIN
1ut4_B3e-52816414167NO APICAL MERISTEM PROTEIN
1ut7_A3e-52816414167NO APICAL MERISTEM PROTEIN
1ut7_B3e-52816414167NO APICAL MERISTEM PROTEIN
4dul_A3e-52816414167NAC domain-containing protein 19
4dul_B3e-52816414167NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160164KKKSH
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818001e-140LN681800.1 Cucumis melo genomic scaffold, anchoredscaffold00017.
GenBankLN7132551e-140LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148307.10.0PREDICTED: NAC domain-containing protein 76-like
SwissprotQ9MA171e-101SMB_ARATH; Protein SOMBRERO
TrEMBLA0A0A0K4750.0A0A0A0K475_CUCSA; Uncharacterized protein
STRINGXP_004148307.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72043447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-103NAC family protein
Publications ? help Back to Top
  1. Fendrych M, et al.
    Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis.
    Curr. Biol., 2014. 24(9): p. 931-40
    [PMID:24726156]
  2. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  3. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  4. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]