PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 176aa    MW: 19924.9 Da    PI: 7.2686
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005052genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.61.4e-40141131100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+C ++C l pyfp ++p kf ++h++FGasn++kll++lp+++r da++s+vyeA ar+rdP+yG++g i++lq+q++ l+ ela++++e
  Cla005052  14 PCAACKILRRRCRENCELGPYFPPTEPLKFTIAHRVFGASNIIKLLQDLPKSQRADAVNSMVYEASARIRDPIYGCAGSIFQLQKQINDLQGELAKAQAE 113
                7**********************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.37813114IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4014111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MEKNEAHTVA VGSPCAACKI LRRRCRENCE LGPYFPPTEP LKFTIAHRVF GASNIIKLLQ  60
DLPKSQRADA VNSMVYEASA RIRDPIYGCA GSIFQLQKQI NDLQGELAKA QAEVLKMQCQ  120
QANLMTLICK ELAQMPQPPM YDHQPLNQNY NISSPQSYQT YSYLFEEGNI LEPLWT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132665e-93LN713266.1 Cucumis melo genomic chromosome, chr_12.
GenBankLN6819285e-93LN681928.1 Cucumis melo genomic scaffold, anchoredscaffold00004.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004147298.11e-107PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR07e-63LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0A0LUS41e-107A0A0A0LUS4_CUCSA; Uncharacterized protein
STRINGVIT_06s0004g03330.t012e-72(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2450033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-64LOB domain-containing protein 1