PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla004725
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 131aa    MW: 14612.2 Da    PI: 8.6581
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla004725genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26065.11.7e-202067148
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllka 48
               +CaaCk+lrr+C+++Cvlapyfp ++p kfa+vhk+FGa nv+k+l+ 
  Cla004725 20 PCAACKILRRRCVDKCVLAPYFPPTEPLKFAAVHKIFGAGNVIKFLQV 67
               7********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.74319123IPR004883Lateral organ boundaries, LOB
PfamPF031959.6E-202068IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MAKNMQSPPP PPSSMVVLSP CAACKILRRR CVDKCVLAPY FPPTEPLKFA AVHKIFGAGN  60
VIKFLQVIGN RCDTYLDDGW VRLNAKLAFA MDSLRKKCEH VEDSFPTEKC SCSYWTSWVH  120
ASGCFSVILN I
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0A0KU201e-30A0A0A0KU20_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.13e-27LOB domain-containing protein 11