PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla004491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family GRAS
Protein Properties Length: 545aa    MW: 60752.7 Da    PI: 5.814
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla004491genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS430.71.2e-1311765442373
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                +e L +cA+a++++d+   ++l+++l+ ++s +g+p++Rl ay++eAL ar a+s+s++ykal+++e      +e l++++++++++P++kf++l aN a
  Cla004491 176 KEMLCACARAIEENDMMTGEWLVSELRGMVSVSGEPIKRLGAYLLEALVARTASSGSSIYKALRCKEPI---GAELLSYMHVLYDICPYFKFGYLSANGA 272
                789*****************************************************************9...9*************************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpg 199
                I ea++ge+rvHiiDf+i qG QW++L+qaLa+Rp+gpp++ iTg+++++s   +   le +g+rL+ +Ae+l+vpfef+  +a + ++++ e+L+v+pg
  Cla004491 273 IAEAIKGENRVHIIDFQIAQGNQWITLMQALANRPGGPPKVTITGIDDSTSAfaRGGGLEIVGKRLTILAESLNVPFEFHG-IAGSASEIQREDLKVQPG 371
                ************************************************99889999*************************.6999************** PP

       GRAS 200 EalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvva 299
                Ea+aV+++l lh+++desv ++++rd++L+lvkslsPkvv+vve+e++ n+++F+ rfl++l+yy+a+f+s++++lpr+++eri+vE+++l+r+ivn+va
  Cla004491 372 EAIAVSFALVLHHMPDESVGSQNHRDRILRLVKSLSPKVVTVVEHESNNNTAPFFPRFLQTLKYYTAVFESIDVTLPRDHKERINVEQHCLARDIVNLVA 471
                **************************************************************************************************** PP

       GRAS 300 cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                ceg er+erhe ++kWr+rl +aGFkp pls ++++++++ll+++ +  y++ee++g l+lgW +++Lv+ SaW
  Cla004491 472 CEGPERVERHELFGKWRSRLLMAGFKPHPLSPFVNATIEALLKNYCD-KYTLEERDGVLYLGWLNQNLVTSSAW 544
                *********************************************95.5************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.614149526IPR005202Transcription factor GRAS
PfamPF035144.1E-129176544IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MQEPSRKKVP NQSHRFYEQP QQEPGSCYWP PINHGGVLYP DDVYEQNHLP SETFKHSCNL  60
ESSSGTSSYP PQNSSSTASF TSNGSPSSHQ ECHSYPLDPY YSPDNNCGSP VSRSCLTDAT  120
ADDLRHKIRE LETAMLGPDA DRLDIYSVTE PVNPVLPVQE MGWNDVAEII SRRDLKEMLC  180
ACARAIEEND MMTGEWLVSE LRGMVSVSGE PIKRLGAYLL EALVARTASS GSSIYKALRC  240
KEPIGAELLS YMHVLYDICP YFKFGYLSAN GAIAEAIKGE NRVHIIDFQI AQGNQWITLM  300
QALANRPGGP PKVTITGIDD STSAFARGGG LEIVGKRLTI LAESLNVPFE FHGIAGSASE  360
IQREDLKVQP GEAIAVSFAL VLHHMPDESV GSQNHRDRIL RLVKSLSPKV VTVVEHESNN  420
NTAPFFPRFL QTLKYYTAVF ESIDVTLPRD HKERINVEQH CLARDIVNLV ACEGPERVER  480
HELFGKWRSR LLMAGFKPHP LSPFVNATIE ALLKNYCDKY TLEERDGVLY LGWLNQNLVT  540
SSAWI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-641775446374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
GenBankLN6818600.0LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008449075.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_008449076.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_008449077.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0A0L6540.0A0A0A0L654_CUCSA; Uncharacterized protein
STRINGVIT_19s0090g01740.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16533497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein