PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla003443
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 167aa    MW: 18658.3 Da    PI: 8.0584
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla003443genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.61.1e-4313111199
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv kll+++ +++r+da+ sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+++k+
  Cla003443  13 PCAACKFLRRKCLEGCVFAPYFPPEEPQKFANVHKVFGASNVAKLLNDVLPHQRQDAVVSLAYEAEARIRDPVYGCVGAISFLQKQVQKLQKELDAAKA 111
                7*********************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.74812113IPR004883Lateral organ boundaries, LOB
PfamPF031956.4E-4413110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MGSTTTNSHY YSPCAACKFL RRKCLEGCVF APYFPPEEPQ KFANVHKVFG ASNVAKLLND  60
VLPHQRQDAV VSLAYEAEAR IRDPVYGCVG AISFLQKQVQ KLQKELDAAK ACLFLYSCTD  120
FSTPLLPPHP QIITTPHPLI WNNNLNLNLN NNNHDITNSS MYFNGGI
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132661e-176LN713266.1 Cucumis melo genomic chromosome, chr_12.
GenBankLN6819321e-176LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002281358.13e-68PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_003523096.14e-68PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_006578652.14e-68PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_010663111.13e-68PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_010663112.13e-68PREDICTED: protein LATERAL ORGAN BOUNDARIES
RefseqXP_010663113.13e-68PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML42e-62LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0A0LTL02e-93A0A0A0LTL0_CUCSA; Uncharacterized protein
STRINGVIT_17s0000g09010.t019e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2447133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-54LBD family protein