PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla003039
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 240aa    MW: 27960.6 Da    PI: 5.4771
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla003039genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1431.7e-44161462128
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                ppGfrF Pt+eelv++yL+++++++  e ++vi+ ++iy++ePwdLpk     +++++++w+fF+ r++++++g r++r+t++gyWkatg+   v+s+ +
  Cla003039  16 PPGFRFYPTEEELVSFYLRHQLQTELPEKHRVIPLLNIYNFEPWDLPKsageLCRGDSEQWFFFVARQERETRGGRPSRTTAAGYWKATGSPVYVYSSAN 115
                9************************9999999***************645653444777***************************************** PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                +++glkkt+vfy grap+g+kt+W m+eyr+
  Cla003039 116 KVIGLKKTMVFYMGRAPTGTKTKWKMNEYRA 146
                *****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.11E-4811163IPR003441NAC domain
PROSITE profilePS5100548.81815165IPR003441NAC domain
PfamPF023653.0E-2316145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MSMPMEEEEE SIHEYPPGFR FYPTEEELVS FYLRHQLQTE LPEKHRVIPL LNIYNFEPWD  60
LPKSAGELCR GDSEQWFFFV ARQERETRGG RPSRTTAAGY WKATGSPVYV YSSANKVIGL  120
KKTMVFYMGR APTGTKTKWK MNEYRAIDDS AKLRHEFSLC RIYVISGCFR AFDRRPMEVI  180
AAAQKTADRK MKEKVTSPET SCAAAAMAHC DGSGSNWRMD EDEEFEESIW EWEKIDWAEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-331616318163NO APICAL MERISTEM PROTEIN
1ut4_B7e-331616318163NO APICAL MERISTEM PROTEIN
1ut7_A7e-331616318163NO APICAL MERISTEM PROTEIN
1ut7_B7e-331616318163NO APICAL MERISTEM PROTEIN
3swm_A8e-331616321166NAC domain-containing protein 19
3swm_B8e-331616321166NAC domain-containing protein 19
3swm_C8e-331616321166NAC domain-containing protein 19
3swm_D8e-331616321166NAC domain-containing protein 19
3swp_A8e-331616321166NAC domain-containing protein 19
3swp_B8e-331616321166NAC domain-containing protein 19
3swp_C8e-331616321166NAC domain-containing protein 19
3swp_D8e-331616321166NAC domain-containing protein 19
4dul_A7e-331616318163NAC domain-containing protein 19
4dul_B7e-331616318163NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819287e-96LN681928.1 Cucumis melo genomic scaffold, anchoredscaffold00004.
GenBankLN7132667e-96LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008461272.11e-155PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR33e-81NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A1S3CEB61e-154A0A1S3CEB6_CUCME; NAC domain-containing protein 90-like
STRINGXP_008461272.11e-155(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.13e-80NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]