PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla002400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 576aa    MW: 63625.2 Da    PI: 5.0667
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla002400genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.7e-5291361128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lp GfrF+Ptdeel+++yL+ k++g++ ++ +vi+evd++k+ePwdLp  + +k+++ ew+fF+++d+ky++g+r +rat +gyWkatgkd++++s +++
  Cla002400   9 LPLGFRFRPTDEELIDYYLRSKINGNHEDV-SVIREVDVCKWEPWDLPdlSIIKTKDPEWFFFCPQDRKYPNGHRLKRATVAGYWKATGKDRKIKS-GTK 106
                699************************999.99**************96447788889**************************************.99* PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                l+g+kktLvfykgrapkg++t+Wv+heyr 
  Cla002400 107 LIGMKKTLVFYKGRAPKGKRTNWVVHEYRT 136
                ****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-594159IPR003441NAC domain
PROSITE profilePS5100556.1289159IPR003441NAC domain
PfamPF023654.3E-2610135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0071470Biological Processcellular response to osmotic stress
GO:1900426Biological Processpositive regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MAVLTLNSLP LGFRFRPTDE ELIDYYLRSK INGNHEDVSV IREVDVCKWE PWDLPDLSII  60
KTKDPEWFFF CPQDRKYPNG HRLKRATVAG YWKATGKDRK IKSGTKLIGM KKTLVFYKGR  120
APKGKRTNWV VHEYRTTLKE LDGTNPGQSA FVLCRLFKKQ DESIEGSNGD EAEAAISSPT  180
TAESSPGPGD SISEPTLPLV SPSLQRPAES SDGVLSETVE HTDGSADIHG FDSYNAEMDP  240
HPDEEKKVCG SENKPLDSKL YSPLHSQLQA ELGSSGIYYS DSNYLNYEAN GNAEQLPSGT  300
EESDLIYQML DSFVYSLDDF PLEDQQEFMS LSEFPNNTMD NLDHGFFSKV EADNVKAMVM  360
PDFESSICLE DIDRKTPIIE HMGTAPPEQG QLYNISGSLQ ESYNPSSVVG STDAATGIQR  420
MSRRPRNLQQ PNEFSTFQGT APRRLRLQSK LVTPASCSSN MEKASENKTI GGNCASDGGA  480
AAVATVDVVK QPQMPNAESR SSSKASQEAS AKSVASYSSK IDFLTGKRRL ATALPPSILS  540
YVSVVRLVVV ALSIIFISIW KCSNREQRGY LVSPFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-44816214171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00108PBMTransfer from AT4G35580Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011653333.10.0PREDICTED: NAC domain-containing protein 74
TrEMBLA0A0A0L0H20.0A0A0A0L0H2_CUCSA; Uncharacterized protein
STRINGXP_004156529.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.12e-98NAC transcription factor-like 9