PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla001587
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 230aa    MW: 25794.1 Da    PI: 8.5685
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla001587genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601101.8e-3414102189
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                aCaaCk++r+kC + C+lapyfpa+++++f++vhk+FG+snv+k++k+++ee++++a++slv+eA +r++dPv G +g ++++ ++l+ 
  Cla001587  14 ACAACKHQRKKCHETCPLAPYFPADRNREFQAVHKVFGVSNVTKMVKNVREEDKRKAVDSLVWEAVCRQNDPVLGPYGEYKRVLEELKV 102
                7*****************************************************************************99998887764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.92313113IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-3314101IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MQKHNNEVLQ TTSACAACKH QRKKCHETCP LAPYFPADRN REFQAVHKVF GVSNVTKMVK  60
NVREEDKRKA VDSLVWEAVC RQNDPVLGPY GEYKRVLEEL KVCKLLTQNQ SIMNGGQVGL  120
GYKPIMPCLG GWNNSNNNNN ASGNSINNGN GIMGIINGGV NSNHLFSYLH DNNVSAIIDS  180
SPYSNSSTYN LQSPEKLMRL QQDKEISSSI VVPLQQQQQQ QHHPTFHHCF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132651e-175LN713265.1 Cucumis melo genomic chromosome, chr_11.
GenBankLN6819161e-175LN681916.1 Cucumis melo genomic scaffold, anchoredscaffold00037.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9LNB93e-46LBD2_ARATH; LOB domain-containing protein 2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127222534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.19e-46LOB domain-containing protein 2