PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla000545
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 196aa    MW: 21279 Da    PI: 6.0892
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla000545genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-42351341100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca+ Cvlapyfp ++p+kfa++h++FGasn++k+l++lpe++r da+sslvyeA ar+rdPvyG++g i +lq+q+++l+a+la++++e
  Cla000545  35 PCAACKILRRRCAERCVLAPYFPPTEPAKFAIAHRVFGASNIIKFLQELPESQRADAVSSLVYEASARIRDPVYGSAGAICQLQKQVNELQAQLAKAQAE 134
                7***********************************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.14334135IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4235132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MEGSDSIATV SSTPLSQSPS SSSSPAPPPP VVLSPCAACK ILRRRCAERC VLAPYFPPTE  60
PAKFAIAHRV FGASNIIKFL QELPESQRAD AVSSLVYEAS ARIRDPVYGS AGAICQLQKQ  120
VNELQAQLAK AQAEVVNMQC QQANLVAFVC RELAQSHHQS FDDFNGSPHN GLLFQSISPS  180
YFDDSNVNSL WEPLWT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132651e-126LN713265.1 Cucumis melo genomic chromosome, chr_11.
GenBankLN6819221e-126LN681922.1 Cucumis melo genomic scaffold, anchoredscaffold00082.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463908.11e-112PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-74LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0A0KCM51e-106A0A0A0KCM5_CUCSA; Uncharacterized protein
STRINGGLYMA13G40370.22e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.19e-64LOB domain-containing protein 1