PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla000516
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family SBP
Protein Properties Length: 1086aa    MW: 121031 Da    PI: 8.6432
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla000516genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP699.5e-22144191148
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                +Cqv++C++dls+ak+yhrrhkvCe hsk++++lv++++qrfCqqCsr
  Cla000516 144 MCQVDNCKEDLSNAKDYHRRHKVCELHSKSSKALVAKQMQRFCQQCSR 191
                6**********************************************9 PP

2SBP45.42.2e-142162464878
                SEEETTT--SS--S-STTTT-------S--- CS
        SBP  48 rfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                rfh lsefD++krsCrrrLa+hn rrrk+q+
  Cla000516 216 RFHPLSEFDDGKRSCRRRLAGHNWRRRKTQP 246
                9***************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.7E-31141231IPR004333Transcription factor, SBP-box
PROSITE profilePS5114125.248142244IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-20143192IPR004333Transcription factor, SBP-box
PfamPF031105.5E-15145191IPR004333Transcription factor, SBP-box
PfamPF031109.2E-8216243IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.93E-11216248IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1086 aa     Download sequence    Send to blast
MDDLGAQVVP PIFIHQPLTS RYADLPSIPK KRALSYQVPN FHHQGQLHPH TWNPKAWDWD  60
SARFLTKPSN HSDTLSSELK RKVDFTAATP SSIHKKTVDV LDDEDDSLRL NLGGGLNLNY  120
VEEPVSKPPK KVRPGSPGAV TYPMCQVDNC KEDLSNAKDY HRRHKVCELH SKSSKALVAK  180
QMQRFCQQCS RNSIPICPRL QTNILTVIAI NNLPLRFHPL SEFDDGKRSC RRRLAGHNWR  240
RRKTQPEDVT SRLTRPGSRG PPSTGNLDIV SLLTVLARAQ GKNEDQSVKS LLSANSDQLI  300
QILNKINSLP LPADLAAKLP NLENFRGKAP PQSSLQHQNK LNGNPSSPST MDLLTVLSAT  360
LATSAPDALA MLSQKSSVSS DSEKTRSSCP SGSDLQNRPM ELPSVGGERS STSYQSPMED  420
SDGQVQGTRV GLPLQLFGSS PEHEAPPNLA ASRKYFSSDS SNPIEERSPS SSPPLLQKLF  480
PVQSTEETTS NGKIPIRKEV SGIEVRKPPS SNIPFELFRE SDRARPNSFR TVPYQAGYTS  540
SGSDHSPSSL NSDAQDRTGR ISFKLFDKDP SQFPGTLRTQ IYNWLSNCPS EMESYIRPGC  600
VVLSVYMSMS SIAWEQLEEN LDLHVKSLIH REELDFWRSG RFLVYAGRQL ASHKDGKIRL  660
NKSSKAWSNP ELISVSPLAV VGGQKTSFLL RGRNLKNPGT RIHCTSMGGY VSEEVMGLSR  720
QGKYDEIHSG SFKVGDVSPT TLGRCFIEVE NGFRGNSFPV IIADATICRE LRHLESDFDE  780
FKVPDISSES HSYVPSQPRL RDEILQFLNE LGWLFQRERF SYELDNPDFL IRRFRFLLTF  840
SAERDFCALV KTLLDILTKK CLITDGLSMK SLEMISEIQL LSRSVKRRCR QMVDLLVHYH  900
VSGFGDAEKK YLFPPNLIGP GGITPLHLAA SMTDADDLVD ALTNDPLEIG LECWSSQLDE  960
NGQSPRAYAL MRGNNSCNEL VERKLGDRKN GQVSVRIRNE IEQLEVSSAE RCRVQSRSCS  1020
RCAVVAAKCN RRVPGSGTHR LLHRPYIHSM LAIAAVCVCV CLFLRGSPDI GLVAPFKWEN  1080
LGYGTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-26135243184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453037.10.0PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A1S3BW180.0A0A1S3BW18_CUCME; squamosa promoter-binding-like protein 14
STRINGXP_008453037.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]