PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla000198
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family HD-ZIP
Protein Properties Length: 278aa    MW: 30745.8 Da    PI: 9.0394
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla000198genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.4e-18135189256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++k+q   Le+ F++n++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Cla000198 135 RKKLRLSKQQAALLEQSFKQNSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 189
                788899***********************************************98 PP

2HD-ZIP_I/II121.15.6e-39135223190
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                  +kk+rlsk+q++lLE+sF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e Lk+++++l++en+rL+ke +eL+ +
    Cla000198 135 RKKLRLSKQQAALLEQSFKQNSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCELLKKCCETLTDENRRLQKELQELK-S 223
                  69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-18122185IPR009057Homeodomain-like
SuperFamilySSF466893.01E-19122192IPR009057Homeodomain-like
PROSITE profilePS5007117.912131191IPR001356Homeobox domain
SMARTSM003895.6E-15133195IPR001356Homeobox domain
PfamPF000466.2E-16135189IPR001356Homeobox domain
CDDcd000861.75E-16135192No hitNo description
PROSITE patternPS000270166189IPR017970Homeobox, conserved site
SMARTSM003406.0E-24191234IPR003106Leucine zipper, homeobox-associated
PfamPF021832.4E-9191224IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGLDDFCQTG LVLGLGLSND QRLKKKPTPC SSSSLDFEPC ALTLGFSGTG GGSETHQKVI  60
DVNNKMMMIN NNNSDVGVHH LHRQEASTHS SSAVCSSFSG GGRVKRERDL SSEEVQLDRL  120
SSRVSDEDED GSNARKKLRL SKQQAALLEQ SFKQNSTLNP KQKQALARQL NLRPRQVEVW  180
FQNRRARTKL KQTEVDCELL KKCCETLTDE NRRLQKELQE LKSLKLAQPL YMQMPAATLT  240
ICPSCERLGS GGGASKPKFS MAPTPHFYNP FSSPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183191RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004149840.21e-138PREDICTED: homeobox-leucine zipper protein HAT22
RefseqXP_008450165.11e-138PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466049e-90HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A0A0LBR71e-137A0A0A0LBR7_CUCSA; Uncharacterized protein
TrEMBLA0A1S3BNL61e-137A0A1S3BNL6_CUCME; homeobox-leucine zipper protein HAT22-like
STRINGXP_004149840.11e-139(Cucumis sativus)
STRINGXP_004166355.11e-139(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-74HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]