PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.9217s0021.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 570aa    MW: 63681.6 Da    PI: 4.3274
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.9217s0021.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.26.5e-5391361128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk+tgk
  Cagra.9217s0021.1.p   9 LAPGFRFHPTDEELVRYYLKRKVCNKPFKF-DAISVTDIYKSEPWDLPgKsKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGK 97 
                          579**************************9.99***************6347777888******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d+e+ + + ++vg+kktLv++kgrap+ge+t+Wvmheyrl
  Cagra.9217s0021.1.p  98 DREIRN-GPRVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
                          *****9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-617159IPR003441NAC domain
PROSITE profilePS5100558.3969159IPR003441NAC domain
PfamPF023656.3E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MGRGSVTSLA PGFRFHPTDE ELVRYYLKRK VCNKPFKFDA ISVTDIYKSE PWDLPGKSKL  60
KSRDLEWYFF SMLDKKYSNG SKTNRATEKG YWKTTGKDRE IRNGPRVVGM KKTLVYHKGR  120
APRGERTNWV MHEYRLSDED LKKAGVPQEA YVLCRIFQKS GTGPKNGEQY GAPFLEEEWE  180
EDAMTYVPDQ DAFSEGLGVD DDVYVDIDDN EEKPENLVVY DAVPILPNYC HGESSNNVES  240
GNYSDSGNYI QQGNYVADSG GYFEQPVETF EEDKKPIIRD GSIQPCSLFP EDQIGCGVQD  300
ENAVNNLDSS NNNVFDADTC YSDIPIDTNY LPDEPFMDPN NNLPLNDGLY LETNDLSCVQ  360
QDDFNFEDYL NFCDDEGFIL DDSQFMGSED ALPDQEGLDQ KLSPEELEKE VAEGKEVVEK  420
KESGEGSCSK RDADLTEFDS ASKYPFLKKT SHMLGAIPAP SSFASQFKSK DAAIRLHSAQ  480
SSGSVHVTAG MIRISNMTLA ADSSMGWSYD KNGNLNVVLS FGVVQRDDEL SASGSKTGTT  540
ATRAMLIFMC LWVLLLSVSF KIVTMVSAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-44816516171NO APICAL MERISTEM PROTEIN
1ut4_B8e-44816516171NO APICAL MERISTEM PROTEIN
1ut7_A8e-44816516171NO APICAL MERISTEM PROTEIN
1ut7_B8e-44816516171NO APICAL MERISTEM PROTEIN
3swm_A9e-44816519174NAC domain-containing protein 19
3swm_B9e-44816519174NAC domain-containing protein 19
3swm_C9e-44816519174NAC domain-containing protein 19
3swm_D9e-44816519174NAC domain-containing protein 19
3swp_A9e-44816519174NAC domain-containing protein 19
3swp_B9e-44816519174NAC domain-containing protein 19
3swp_C9e-44816519174NAC domain-containing protein 19
3swp_D9e-44816519174NAC domain-containing protein 19
4dul_A8e-44816516171NAC domain-containing protein 19
4dul_B8e-44816516171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.9217s0021.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0996090.0AY099609.1 Arabidopsis thaliana putative protein (At5g04410) mRNA, complete cds.
GenBankAY1288590.0AY128859.1 Arabidopsis thaliana putative protein (At5g04410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023635794.10.0NAC domain-containing protein 78 isoform X2
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLD7LXI40.0D7LXI4_ARALL; Uncharacterized protein
STRINGCagra.9217s0021.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]