PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.9128s0007.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 236aa    MW: 25745.2 Da    PI: 4.764
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.9128s0007.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-42581571100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r+da++s+vyeA ar+rdPvyG++g i +lq+q+++l
  Cagra.9128s0007.1.p  58 PCAACKILRRRCAEKCVLAPYFPPTDPMKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAGARMRDPVYGCAGAIYHLQRQVSEL 147
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+la+++ e
  Cagra.9128s0007.1.p 148 QAQLAKTQVE 157
                          *****99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.22857158IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-4258155IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MLKMEINGGV ATPTASAVAV AVAVAETTTP VSSPSPTSSP PPPPSPQQPP QPPVVLSPCA  60
ACKILRRRCA EKCVLAPYFP PTDPMKFTIA HRVFGASNII KFLQELPESQ RTDAVNSMVY  120
EAGARMRDPV YGCAGAIYHL QRQVSELQAQ LAKTQVELVG MQLQRSSLLE LVYKMEQTKL  180
SAQEQGQHKM SFESSFESGD EFISSPDEES NDLGFLEDNN NNNNSSMSWW DPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738400.0AB473840.1 Arabidopsis thaliana ASL7 mRNA for ASYMMETRIC LEAVES2-like 7 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180417.21e-140LOB domain-containing protein 11
SwissprotQ9SK081e-142LBD11_ARATH; LOB domain-containing protein 11
TrEMBLR0FXT91e-140R0FXT9_9BRAS; Uncharacterized protein
STRINGAT2G28500.11e-140(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-110LOB domain-containing protein 11