PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.8436s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GeBP
Protein Properties Length: 319aa    MW: 35875.1 Da    PI: 6.1121
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.8436s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573107.97.3e-3472168298
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          lf r+w+eeDe+v+L+Gl+d++aktg +++ d+dafy+f+  si +k+ k+q+++Kir+LK +f  + +++++g++p+f++++d+++f++
  Cagra.8436s0001.1.p  72 LFTRIWNEEDELVVLKGLVDYRAKTGFQSKIDWDAFYRFLAVSIVSKYAKDQVLSKIRKLKSRFLVHLERINQGSDPKFTRASDSEAFGF 161
                          699*************************************************************************************** PP

               DUF573  92 skkiWgs 98 
                          s+++Wg+
  Cagra.8436s0001.1.p 162 SMMLWGQ 168
                          *****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.0E-2473167IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MVSPKHLEFS SSGGAADDSD DTFSRQKSPV SPHSSKRAAS VAEEETKQKK KHKMKKKIKK  60
KTTTTTQLGS PLFTRIWNEE DELVVLKGLV DYRAKTGFQS KIDWDAFYRF LAVSIVSKYA  120
KDQVLSKIRK LKSRFLVHLE RINQGSDPKF TRASDSEAFG FSMMLWGQNE ANDDGMDKEQ  180
EEPLNENGAP DNNGAARVEQ QSENGEEMLK ENEEVANTEP LNENGAVKVT ENGTAAAKES  240
HDVDDDDELY AVRDAFETVM SQGLSDYQKK LQLKKLMNIG NGKRRELSDE WKALCVEERR  300
LNIKKLRFSA KLAEAANE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006295898.10.0hypothetical protein CARUB_v10025028mg
TrEMBLR0G0S30.0R0G0S3_9BRAS; Uncharacterized protein
STRINGAT4G00270.11e-126(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61171741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00270.11e-121DNA-binding storekeeper protein-related transcriptional regulator