PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.8436s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GeBP
Protein Properties Length: 319aa    MW: 35875.1 Da    PI: 6.1121
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.8436s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573107.97.3e-3472168298
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          lf r+w+eeDe+v+L+Gl+d++aktg +++ d+dafy+f+  si +k+ k+q+++Kir+LK +f  + +++++g++p+f++++d+++f++
  Cagra.8436s0001.1.p  72 LFTRIWNEEDELVVLKGLVDYRAKTGFQSKIDWDAFYRFLAVSIVSKYAKDQVLSKIRKLKSRFLVHLERINQGSDPKFTRASDSEAFGF 161
                          699*************************************************************************************** PP

               DUF573  92 skkiWgs 98 
                          s+++Wg+
  Cagra.8436s0001.1.p 162 SMMLWGQ 168
                          *****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.0E-2473167IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MVSPKHLEFS SSGGAADDSD DTFSRQKSPV SPHSSKRAAS VAEEETKQKK KHKMKKKIKK  60
KTTTTTQLGS PLFTRIWNEE DELVVLKGLV DYRAKTGFQS KIDWDAFYRF LAVSIVSKYA  120
KDQVLSKIRK LKSRFLVHLE RINQGSDPKF TRASDSEAFG FSMMLWGQNE ANDDGMDKEQ  180
EEPLNENGAP DNNGAARVEQ QSENGEEMLK ENEEVANTEP LNENGAVKVT ENGTAAAKES  240
HDVDDDDELY AVRDAFETVM SQGLSDYQKK LQLKKLMNIG NGKRRELSDE WKALCVEERR  300
LNIKKLRFSA KLAEAANE*
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein, which specifically recognizes the GL1 enhancer sequence (PubMed:12535344). May be involved in leaf initiation (PubMed:12535344). May play redundant roles with GPL1 and GPL2 in cytokinin responses by regulating the transcript levels of type-A ARR response genes (PubMed:18162594). Involved in stress responses (PubMed:21875893). Plays a repressive role in cell expansion by counteracting the positive role of CPR5 in this process, but does not regulate cell proliferation or endoreduplication (PubMed:21875893). May play a role in plant defense (PubMed:29192025). {ECO:0000269|PubMed:12535344, ECO:0000269|PubMed:21875893, ECO:0000269|PubMed:29192025, ECO:0000305|PubMed:18162594}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.8436s0001.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by KNAT1. Not regulated by gibberellins. {ECO:0000269|PubMed:12535344}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006295898.10.0GLABROUS1 enhancer-binding protein
SwissprotQ9ASZ11e-127STKLO_ARATH; GLABROUS1 enhancer-binding protein
TrEMBLR0G0S30.0R0G0S3_9BRAS; Uncharacterized protein
STRINGCagra.8436s0001.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61171741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00270.11e-121DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Nietzsche M,Schießl I,Börnke F
    The complex becomes more complex: protein-protein interactions of SnRK1 with DUF581 family proteins provide a framework for cell- and stimulus type-specific SnRK1 signaling in plants.
    Front Plant Sci, 2014. 5: p. 54
    [PMID:24600465]
  2. Nietzsche M, et al.
    STOREKEEPER RELATED1/G-Element Binding Protein (STKR1) Interacts with Protein Kinase SnRK1.
    Plant Physiol., 2018. 176(2): p. 1773-1792
    [PMID:29192025]