PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.6845s0027.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 184aa    MW: 21313.4 Da    PI: 6.3051
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.6845s0027.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.73.4e-1574131562
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          +++rr+ +NRe+ArrsR RK+  ++eL   v+ L +eN++L ++l++ ++  + + +e
  Cagra.6845s0027.1.p  74 RKQRRMVSNRESARRSRMRKQRHLDELMSQVAWLRSENHQLLDKLNQVSDSNDHVVQE 131
                          689********************************************99988766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-1570134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.00172135IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-1273127No hitNo description
PfamPF001705.2E-1374130IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.81E-1374124No hitNo description
CDDcd147027.82E-1975122No hitNo description
PROSITE patternPS0003607792IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MQPNYDSLSL NNMQQQDYFH LNNYYNNLTP STNNNLNLLQ YPQIHQELNL QSPASNNSTT  60
SDDATEGIFV INERKQRRMV SNRESARRSR MRKQRHLDEL MSQVAWLRSE NHQLLDKLNQ  120
VSDSNDHVVQ ENLNLKEENL ELRQVITSMK KLGGGIHEKY PSSSSMDEDF SSITDDPRSH  180
HPS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18693RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00512DAPTransfer from AT5G15830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankBT0036830.0BT003683.1 Arabidopsis thaliana At5g15830 mRNA, complete cds.
GenBankAL3911440.0AL391144.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F14F8 (ESSA project).
GenBankAK1178280.0AK117828.1 Arabidopsis thaliana At5g15830 mRNA for putative bZIP transcription factor AtbZip3, complete cds, clone: RAFL18-02-O03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288751.11e-131hypothetical protein CARUB_v10002068mg
SwissprotQ9FMC24e-34BZP43_ARATH; Basic leucine zipper 43
TrEMBLR0GXL91e-131R0GXL9_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__1562__AT5G15830.11e-102(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM106321532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15830.17e-82basic leucine-zipper 3