PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.6288s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GeBP
Protein Properties Length: 255aa    MW: 29117.2 Da    PI: 7.8033
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.6288s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57335.92.1e-1184114232
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsd 32 
                          +fqr+wse+De+++LqGlid+k++t+ ++ +
  Cagra.6288s0001.1.p  84 NFQRVWSEDDEVAILQGLIDYKTDTKGEALE 114
                          79********************999876555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.4E-785113IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MTFKRFTRVF EGFFKVDPNI LVLTEKKVEA GVTVKKVEAP MKLVVTEKQE VNRSVEKRSP  60
ETTNEGDSVK RVKVSEKKEK KKPNFQRVWS EDDEVAILQG LIDYKTDTKG EALESTGKSK  120
RVASLKHEDA ERVSSSLVRT LVYVGVDELA AQQGLSMIAL EDKKRYEEQK ALQAREFDFY  180
SEKAKFLHQI TLVHFGVDEL AAQQGLSRLA SEDMKRYEEQ WKALQAREFD FYSEKAGLLH  240
QMLAEMVEAS RSNV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.6288s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023633405.11e-102probable transcription factor At1g11510
TrEMBLR0GLZ11e-158R0GLZ1_9BRAS; Uncharacterized protein
STRINGCagra.6288s0001.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3360422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.12e-19DNA-binding storekeeper protein-related transcriptional regulator