PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.5575s0004.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 129aa    MW: 14209.1 Da    PI: 8.109
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.5575s0004.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.31.5e-448106199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC++dCv+apyfp e+p kfanvh++FGasnv+k+l+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l
  Cagra.5575s0004.1.p   8 PCAACKFLRRKCTSDCVFAPYFPPEEPTKFANVHRIFGASNVSKILQEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVLRL 97 
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          + el+++++
  Cagra.5575s0004.1.p  98 QRELEETNA 106
                          ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.4467108IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-448105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MSNYTNSPCA ACKFLRRKCT SDCVFAPYFP PEEPTKFANV HRIFGASNVS KILQEVAPHQ  60
REDAVNSLAY EAEARLKDPV YGCVGAISVL QRQVLRLQRE LEETNADLMR YASCLGGETT  120
SAYGGRRG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2373361e-164AC237336.1 Arabidopsis lyrata clone JGIFAFI-69G3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292048.12e-92hypothetical protein CARUB_v10018238mg
RefseqXP_010425543.12e-92PREDICTED: LOB domain-containing protein 25
RefseqXP_010502770.12e-92PREDICTED: LOB domain-containing protein 25
SwissprotQ8L8Q38e-93LBD25_ARATH; LOB domain-containing protein 25
TrEMBLR0FRU73e-92R0FRU7_9BRAS; Uncharacterized protein
STRINGAT3G27650.12e-90(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.12e-80LOB domain-containing protein 25