PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.5249s0021.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 309aa    MW: 33462.5 Da    PI: 7.8308
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.5249s0021.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1201.5e-061872321863
                          HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          +rsR RK+++i+eLe+ v+ L++   +L  ++ +l ++ a+l  e+
  Cagra.5249s0021.2.p 187 QRSRVRKLQYIAELERTVAMLQSVEADLSVRVASLLQTRATLSLEN 232
                          79******************************99999999988776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147036.23E-15181226No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-5187239No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MSRPAQLPPR CPIPKKLSLN PVADTFYSSS SPVDSYIAQY KSSTHDSRLE DQPAWLDELL  60
CDKTDGMLTG GGGGGPLRRS ASDSVVLLGD ISADFSGFNQ SEDDESLTSE PCGELESASC  120
VYGPNSPRAK NNSSFSNNPI VSAFSDYGSQ KPPQNLDNTV KGIDFSPVGE TACGSMGVPN  180
AKRNPGQRSR VRKLQYIAEL ERTVAMLQSV EADLSVRVAS LLQTRATLSL ENSQLKQQMA  240
ILKQEKLIRE GEYQLLKKEA QRLKSGLGYS GSNNRLVRSY SAGSNIVPRK ASSHLDWNLV  300
DLTKLNLN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0087100.0BT008710.1 Arabidopsis thaliana At5g04840 gene, complete cds.
GenBankAY0998810.0AY099881.1 Arabidopsis thaliana unknown protein (At5g04840) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288293.10.0hypothetical protein CARUB_v10001536mg
TrEMBLR0FGT40.0R0FGT4_9BRAS; Uncharacterized protein
STRINGAT5G04840.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.26e-19bZIP family protein