PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.5118s0045.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 191aa    MW: 20753.4 Da    PI: 8.2137
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.5118s0045.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601438.9e-4511109199
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l
  Cagra.5118s0045.1.p  11 PCAACKFLRRKCMPGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVHRL 100
                          7***************************************************************************************** PP

               DUF260  91 kaelallke 99 
                          ++el+++++
  Cagra.5118s0045.1.p 101 QKELDAANA 109
                          ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089128.18310111IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-4411108IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MASSSNSYNS PCAACKFLRR KCMPGCIFAP YFPPEEPHKF ANVHKIFGAS NVTKLLNELL  60
PHQREDAVNS LAYEAEARVR DPVYGCVGAI SYLQRQVHRL QKELDAANAD LAHYGLSTSA  120
AGTPGNVVDL VFQPQPLQST QQQPPPLNPV YRLSGANPVM TQLPRGTGGS YGTFLPWNNG  180
HDQQQQGGNM *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2546060.0AC254606.1 Capsella rubella clone CAP16-M12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282142.11e-141hypothetical protein CARUB_v10028397mg
SwissprotQ9FML41e-131LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLR0GRT81e-141R0GRT8_9BRAS; Uncharacterized protein
STRINGAT5G63090.11e-129(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-113LBD family protein