PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4849s0008.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 492aa    MW: 56452.9 Da    PI: 4.9273
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4849s0008.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.95.4e-5561331128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          lppGfrFhPtdeel+++yLk+k++g+++el e+i+evd+yk+ePwdLp k  + ++++ewyfFs+rd+ky++g+r+nratk gyWkatgk
  Cagra.4849s0008.1.p   6 LPPGFRFHPTDEELITYYLKRKINGREIEL-EIISEVDLYKCEPWDLPgKsLLPSKDQEWYFFSPRDRKYPNGSRTNRATKGGYWKATGK 94 
                          79****************************.99***************6345667999******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d++v   +++++g+kktLv+y+grap+g +t Wvmheyrl
  Cagra.4849s0008.1.p  95 DRRVSW-RDRAIGTKKTLVYYRGRAPHGIRTGWVMHEYRL 133
                          *****9.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-624157IPR003441NAC domain
PROSITE profilePS5100561.0796157IPR003441NAC domain
PfamPF023654.5E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090602Biological Processsieve element enucleation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI TYYLKRKING REIELEIISE VDLYKCEPWD LPGKSLLPSK  60
DQEWYFFSPR DRKYPNGSRT NRATKGGYWK ATGKDRRVSW RDRAIGTKKT LVYYRGRAPH  120
GIRTGWVMHE YRLDETECEP SAFGMQDAYA LCRVFKKIVI ETKPRDQHQQ QQHQPYVHCS  180
SNLSGNSSFD VSSDLEISSN TQQVLPYSNI TDTQPRMGNA NSISVHDDWS QYLSQDMPSS  240
FSGYGQYLTQ SKVNTDQECE MLQHQMSLPP LRVENSPVQA IDLSNRLNQN GGFDDFTFAP  300
SNSNQFSNVD DHLIHIGNLD DQLLNAGNMS SWMTMSNENL NQSFIEEEEI LPSFERNDQD  360
LDHYYGGSPT NTINNIEIDD FFSFENDVED HDNSNITLNS SGVGMIEEEI VVNHKMLICT  420
RQTAETLYYQ VVPSQLLKIH ISPVQGTEER AMLMDEGNDS WFQKAENVAK MKLKQISLVA  480
KRYYKCLTIV F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-54115712165NO APICAL MERISTEM PROTEIN
1ut4_B1e-54115712165NO APICAL MERISTEM PROTEIN
1ut7_A1e-54115712165NO APICAL MERISTEM PROTEIN
1ut7_B1e-54115712165NO APICAL MERISTEM PROTEIN
3swm_A1e-54415718168NAC domain-containing protein 19
3swm_B1e-54415718168NAC domain-containing protein 19
3swm_C1e-54415718168NAC domain-containing protein 19
3swm_D1e-54415718168NAC domain-containing protein 19
3swp_A1e-54415718168NAC domain-containing protein 19
3swp_B1e-54415718168NAC domain-containing protein 19
3swp_C1e-54415718168NAC domain-containing protein 19
3swp_D1e-54415718168NAC domain-containing protein 19
4dul_A1e-54115712165NAC domain-containing protein 19
4dul_B1e-54115712165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.4849s0008.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052381e-114AB005238.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MKP11.
GenBankCP0026881e-114CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006290189.10.0NAC domain-containing protein 86 isoform X1
SwissprotQ9FFI50.0NAC86_ARATH; NAC domain-containing protein 86
TrEMBLR0FKW50.0R0FKW5_9BRAS; Uncharacterized protein
STRINGCagra.4849s0008.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44111852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17260.10.0NAC domain containing protein 86
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]