PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4538s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family Dof
Protein Properties Length: 337aa    MW: 36279.9 Da    PI: 9.9344
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4538s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.4e-3994152462
               zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            lkcprCds+ntkfCy+nny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r+nkk +
  Cagra.4538s0003.1.p  94 GVLKCPRCDSANTKFCYFNNYNLTQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKKGK 152
                          5789***************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3677147IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3295150IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.68396150IPR003851Zinc finger, Dof-type
PROSITE patternPS01361098134IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MVFSTVSSFL DPPINWPQSS TNSNNHPHHL QLQESGSLVS AHHQVLSHHF PQNPNPNHHH  60
VDTTVAAATI DPGSLNGQAA ERARLAKNHQ PPEGVLKCPR CDSANTKFCY FNNYNLTQPR  120
HFCKACRRYW TRGGALRNVP VGGGCRRNKK GKSVSSKSSS SSSQNKPSTS MVNATSPTTT  180
SNVHLQPNSQ FPFLPTLQNL THLGGIGLNL APMNGNTSSS SFLNDLGFYH GGNTSGPVMS  240
NNNNNENNNI MTSLGTANNN FALFDRTMGL FNFPNESNMG LSSSGATRAS QTAPVKMEDI  300
SRSVSGLTSQ GNQSNQYWTG TGLPGSSSNN HHQHLM*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.4538s0003.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0328770.0BT032877.1 Arabidopsis thaliana unknown protein (At2g28810) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294546.10.0dof zinc finger protein DOF2.2 isoform X1
SwissprotQ9ZV330.0DOF22_ARATH; Dof zinc finger protein DOF2.2
TrEMBLR0HD440.0R0HD44_9BRAS; Uncharacterized protein
STRINGCagra.4538s0003.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.11e-163Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]