PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4395s0089.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NF-YB
Protein Properties Length: 143aa    MW: 16061.8 Da    PI: 7.5092
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4395s0089.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB163.52.9e-51297297
                NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
                         +++dr+lPianv+r+mk++lP+nakisk+ak+tvqec++efisfvt+easdkc+re+rkt+ngdd++wal+tlG+++y++++  +l+kyre+
  Cagra.4395s0089.1.p  2 TDEDRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASDKCHRENRKTVNGDDIWWALSTLGLDNYADAVGRHLHKYREA 93
                         689***************************************************************************************** PP

                NF-YB 94 egek 97
                         e+e+
  Cagra.4395s0089.1.p 94 ERER 97
                         *997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.9E-482120IPR009072Histone-fold
SuperFamilySSF471133.49E-384116IPR009072Histone-fold
PfamPF008081.2E-25771IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.9E-163553No hitNo description
PROSITE patternPS0068503854IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.9E-165472No hitNo description
PRINTSPR006153.9E-167391No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MTDEDRLLPI ANVGRLMKQI LPSNAKISKE AKQTVQECAT EFISFVTCEA SDKCHRENRK  60
TVNGDDIWWA LSTLGLDNYA DAVGRHLHKY REAERERAEH NKGSNTDSGN EKEPNTRSDL  120
QNQSTKFVRV VEKGSSSTPR LN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-39192192Transcription factor HapC (Eurofung)
4g92_B1e-39192192Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00133DAPTransfer from AT1G09030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.4395s0089.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankF7G190.0AC000106.1 Sequence of BAC F7G19 from Arabidopsis thaliana chromosome 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304477.11e-104nuclear transcription factor Y subunit B-4
SwissprotO040275e-96NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLR0IG981e-102R0IG98_9BRAS; Uncharacterized protein
STRINGCagra.4395s0089.1.p1e-103(Capsella grandiflora)
STRINGXP_006304477.11e-103(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.12e-98nuclear factor Y, subunit B4
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]