PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4044s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family M-type_MADS
Protein Properties Length: 328aa    MW: 38026.4 Da    PI: 5.6284
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4044s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.61.8e-141151343
                         --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
               SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                         +en+  r  ++ +Rr+ +lKK +EL +LCd+++++iifs++
  Cagra.4044s0006.1.p 11 VENDKARAKSLKQRREALLKKVKELTILCDIQACLIIFSPN 51
                         69999**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.741151IPR002100Transcription factor, MADS-box
SMARTSM004324.6E-16160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-18394IPR002100Transcription factor, MADS-box
CDDcd002662.27E-24385No hitNo description
PRINTSPR004044.9E-5323IPR002100Transcription factor, MADS-box
PfamPF003193.3E-121151IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-52338IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-53859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MPRKNVKLAW VENDKARAKS LKQRREALLK KVKELTILCD IQACLIIFSP NEVGPVVWPS  60
VEKARGLLDD FFALPELAQK NKETSIESFL KEKTKTVHKK LMESDKKNKE YVIDELMMHL  120
QNGRAISDLN LSEIYALLSF SKEKIIHFRN ELGFMQFSPL RDPPMLPFEV QVEQLMIPTN  180
HDVVATTRET KNHYLIDQWF LDPKPLEPLG YQRSYCPYKG SSSNGNPNLE MELFCPEVMS  240
FLGLGESTAQ PLQHHNMNDN PIMAMNQREQ YSFDFMSHEM EIQEEVNNNT TTTNDDVRNE  300
TTARDDHANM AMFDINRDWL NLNNNHF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.4044s0006.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010451565.11e-136PREDICTED: agamous-like MADS-box protein AGL92
RefseqXP_010513278.11e-136PREDICTED: agamous-like MADS-box protein AGL36
TrEMBLR0HWZ50.0R0HWZ5_9BRAS; Uncharacterized protein
STRINGCagra.4044s0006.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.11e-101AGAMOUS-like 48