PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.4003s0027.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 350aa    MW: 39791.8 Da    PI: 5.0089
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.4003s0027.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.12e-5481362129
                  NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          ppG+rFhPtdeelv++yLk+kv+   +++ +vik+vd+yk+ePwd+++   + ++ee+ewyfFs++dkky+tg+r+nrat sg+Wkatg+
  Cagra.4003s0027.1.p   8 PPGYRFHPTDEELVDYYLKNKVAYPGMQV-DVIKDVDLYKIEPWDIQElcgRGTGEEREWYFFSHKDKKYPTGTRTNRATGSGFWKATGR 96 
                          9****************************.99**************954555555788******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                          dk+++s k+elvg++ktLvfykgrap+g+k+dW+mheyrle
  Cagra.4003s0027.1.p  97 DKAIYS-KQELVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                          ******.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-605156IPR003441NAC domain
PROSITE profilePS5100558.3787156IPR003441NAC domain
PfamPF023653.4E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0010981Biological Processregulation of cell wall macromolecule metabolic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0090058Biological Processmetaxylem development
GO:0005634Cellular Componentnucleus
GO:0009531Cellular Componentsecondary cell wall
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MESLSHIPPG YRFHPTDEEL VDYYLKNKVA YPGMQVDVIK DVDLYKIEPW DIQELCGRGT  60
GEEREWYFFS HKDKKYPTGT RTNRATGSGF WKATGRDKAI YSKQELVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GPPHEEGWVV CRAFKKKLTT MNYNNPRTMM GSSAGQESNW  180
FTQQMDVANG NYYHLPDLES PRMFQGSSSS SLSSLHQNDQ DPYGVVLSTI NANPTTIMQR  240
DDGHVMSNDD DHMIMMNTST GGHHQSGLLV NDDHNDQVMD WQTLDKFVAS QLIMSQEEEE  300
VNKDPSDNSS NETFHHLSEE QATMVSINGN ASSSSSPCSF YSWAQNTQT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-50215710169Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', and to the tracheary elements (TE) specific regulating cis-element (TERE), 5'-CTTNAAAGCNA-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20952636, PubMed:20488898). Involved in xylem formation in roots and shoots, especially regulating metaxylem vessel differentiation by promoting immature xylem vessel-specific genes expression, especially genes regulating programmed cell death (PCD) and secondary wall formation in tracheary elements (TE) (PubMed:16103214, PubMed:20952636, PubMed:20488898). Can activate MYB25, MYB46, MYB58, MYB63, MYB83, MYB103, CESA4, LBD15, LBD30, ERF115, XCP1, XCP2, NAC010/SND3, KNAT7, ASL19 and ASL20 expression (PubMed:17890373, PubMed:18952777, PubMed:19088331, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:20952636). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:19088331, ECO:0000269|PubMed:19122102, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:20488898, ECO:0000269|PubMed:20935069, ECO:0000269|PubMed:20952636}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00578DAPTransfer from AT5G62380Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.4003s0027.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:23023171}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0265100.0BT026510.1 Arabidopsis thaliana At5g62380 mRNA, complete cds.
GenBankDQ0567340.0DQ056734.1 Arabidopsis thaliana no apical meristem family protein (At5g62380) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280728.10.0NAC domain-containing protein 101
SwissprotQ9LVA10.0NC101_ARATH; NAC domain-containing protein 101
TrEMBLR0EXL10.0R0EXL1_9BRAS; Uncharacterized protein
STRINGCagra.4003s0027.1.p0.0(Capsella grandiflora)
STRINGXP_006280728.10.0(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122481732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62380.10.0NAC-domain protein 101
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]