PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3807s0064.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ARR-B
Protein Properties Length: 537aa    MW: 60151.4 Da    PI: 6.3016
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3807s0064.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.93.4e-26183236155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+ Wt+eLH++F++av++L G ekA+Pk+il+lm+v+ Lt+e+v+SHLQk+R+
  Cagra.3807s0064.1.p 183 KARVIWTHELHNKFLSAVDHL-GVEKAVPKKILDLMNVDKLTRENVASHLQKFRV 236
                          68*******************.********************************7 PP

2Response_reg86.48e-29191271109
                          EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHH CS
         Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedale 88 
                          vl vdD+++ +++l+++l + +y +v+++ +++ alell+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++++++ +
  Cagra.3807s0064.1.p  19 VLAVDDDQTCLRILQTLLHRCQY-HVTTTNQAQTALELLRENRnkFDLVISDVDMPDMDGFKLLELVGL-EMDLPVIMLSAHSDPKYVMK 106
                          799********************.***************999889*******************87754.558***************** PP

                          HHHTTESEEEESS--HHHHHH CS
         Response_reg  89 alkaGakdflsKpfdpeelvk 109
                           +k Ga d+l Kp+ +eel +
  Cagra.3807s0064.1.p 107 GVKHGACDYLLKPVRIEELKN 127
                          ******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.5E-1591524IPR017053Response regulator B-type, plant
SuperFamilySSF521727.12E-3716144IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.7E-4416167No hitNo description
SMARTSM004486.1E-3417129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.29418133IPR001789Signal transduction response regulator, receiver domain
PfamPF000726.2E-2619127IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.86E-2920132No hitNo description
PROSITE profilePS5129412.485180239IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.7E-27180240IPR009057Homeodomain-like
SuperFamilySSF466891.0E-18181240IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-25183236IPR006447Myb domain, plants
PfamPF002491.2E-5188234IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MTMEHEIEAL DQFPVGMRVL AVDDDQTCLR ILQTLLHRCQ YHVTTTNQAQ TALELLRENR  60
NKFDLVISDV DMPDMDGFKL LELVGLEMDL PVIMLSAHSD PKYVMKGVKH GACDYLLKPV  120
RIEELKNIWQ HVVRKSKLKK SNSSLSNGAG NSDRANRKRK EQYEEEEEEE RGNENDDPTA  180
QKKARVIWTH ELHNKFLSAV DHLGVEKAVP KKILDLMNVD KLTRENVASH LQKFRVALKK  240
VSDEANQQAN RVAIDSQLMQ MSSHKGLGGF YHHRAVPVGS GQFHGEATMM RHYPSNRNIG  300
RLNSLAGGMF QPVSSAFPRN HNERGNILQG LPLPPLEELQ INKAFPSFTS QQNSLMVASN  360
NNHLLLNGHP QSSSPSLNPG FSPQFEINKR LEHWSNTVLS TNIPQSDVHS KPDTLEWTAF  420
CDSASPLINS NLDTNPHPDL GSSSAAQTDF FNPLQVNQQQ ANNSGPITEA QHFRNCDSKQ  480
GLHMASDAGS LDDIVNSLMT QEQSQSDFPE GDWVLDGLAQ TEHGYEKQFF PFSLST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-33179242164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. {ECO:0000269|PubMed:11574878}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00072SELEXTransfer from AT4G31920Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.3807s0064.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0051950.0AJ005195.1 Arabidopsis thaliana mRNA for receiver-like protein 4.
GenBankAK2281490.0AK228149.1 Arabidopsis thaliana mRNA for predicted protein, complete cds, clone: RAFL14-61-J20.
GenBankBT0031580.0BT003158.1 Arabidopsis thaliana At4g31920 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283502.10.0two-component response regulator ARR10
SwissprotO493970.0ARR10_ARATH; Two-component response regulator ARR10
TrEMBLR0GVR20.0R0GVR2_9BRAS; Two-component response regulator
STRINGCagra.3807s0064.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19812879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.10.0response regulator 10
Publications ? help Back to Top
  1. Hill K,Schaller GE
    Enhancing plant regeneration in tissue culture: a molecular approach through manipulation of cytokinin sensitivity.
    Plant Signal Behav, 2013. 8(10): p. doi: 10.4161/psb.25709
    [PMID:23887495]
  2. Ramireddy E,Chang L,Schm├╝lling T
    Cytokinin as a mediator for regulating root system architecture in response to environmental cues.
    Plant Signal Behav, 2014. 9(1): p. e27771
    [PMID:24509549]
  3. Choi SH, et al.
    Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis.
    Sci Rep, 2014. 4: p. 7197
    [PMID:25425016]
  4. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  5. Street IH, et al.
    Cytokinin acts through the auxin influx carrier AUX1 to regulate cell elongation in the root.
    Development, 2016. 143(21): p. 3982-3993
    [PMID:27697901]
  6. Wang Y,Wu Y,Yu B,Yin Z,Xia Y
    EXTRA-LARGE G PROTEINs Interact with E3 Ligases PUB4 and PUB2 and Function in Cytokinin and Developmental Processes.
    Plant Physiol., 2017. 173(2): p. 1235-1246
    [PMID:27986866]
  7. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  8. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  9. Zubo YO, et al.
    Cytokinin induces genome-wide binding of the type-B response regulator ARR10 to regulate growth and development in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(29): p. E5995-E6004
    [PMID:28673986]
  10. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  11. Rong XF, et al.
    Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis.
    Plant Cell Physiol., 2018. 59(4): p. 756-764
    [PMID:29186581]
  12. Bustillo-Avenda├▒o E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]