PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3598s0013.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 122aa    MW: 13659.7 Da    PI: 8.1988
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3598s0013.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.67.9e-4251041100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+C+kdC+++pyfp ++p+kfa++h+++Ga nv+k+l++lpe++r +a++sl++eA++r++dPvyG+vg+i+ lq q++++
  Cagra.3598s0013.1.p   5 RCAACKYLRRRCPKDCIFSPYFPPNDPEKFACIHRIYGAGNVSKMLQQLPEQTRAEAVESLCFEAKCRVDDPVYGCVGIISLLQTQIQNT 94 
                          6***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++ela++++e
  Cagra.3598s0013.1.p  95 QNELAKVQAE 104
                          ******9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.4914105IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-415102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MNPKRCAACK YLRRRCPKDC IFSPYFPPND PEKFACIHRI YGAGNVSKML QQLPEQTRAE  60
AVESLCFEAK CRVDDPVYGC VGIISLLQTQ IQNTQNELAK VQAEVAVAQT KLSQNQNSDF  120
M*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738461e-149AB473846.1 Arabidopsis thaliana ASL13 mRNA for ASYMMETRIC LEAVES2-like 13 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292728.18e-86hypothetical protein CARUB_v10018979mg
SwissprotP594682e-83LBD24_ARATH; LOB domain-containing protein 24
TrEMBLR0FT528e-86R0FT52_9BRAS; Uncharacterized protein
STRINGAT3G26660.15e-81(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-84LOB domain-containing protein 24