PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3501s0144.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 197aa    MW: 22832 Da    PI: 5.6444
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3501s0144.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.53e-1386136555
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                          +++rr+++NRe+ArrsR RK+  ++eL   v  L + N+ L+++l++ ++ 
  Cagra.3501s0144.1.p  86 RKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLIDKLNRVSES 136
                          79*******************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-1382146IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.7E-1184136No hitNo description
PROSITE profilePS5021710.11784136IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.72E-1286135No hitNo description
PfamPF001703.4E-1186137IPR004827Basic-leucine zipper domain
CDDcd147022.96E-1787137No hitNo description
PROSITE patternPS00036089104IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MNTIPAELTG YFHYLSPDKY NNQTPVMESE YFNMPSSPTS SSSFYHLNGL INNNNYSSSS  60
NGQDLMASNN STSDEDHQQS MIIDERKQRR MISNRESARR SRMRKQRHLD ELWSQVIRLR  120
TDNHCLIDKL NRVSESHELA LKENAKLKEE TSDLRQLISE IKSNNEEDNS FLRELEDSIS  180
NSRSDSSQRG RDFELC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198105RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankF21F230.0AC027656.4 Sequence of BAC F21F23 from Arabidopsis thaliana chromosome 1, complete sequence.
GenBankAC0271340.0AC027134.4 Arabidopsis thaliana chromosome I BAC F13B4 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankAF3324300.0AF332430.1 Arabidopsis thaliana clone C00105 (e) putative bZIP transcription factor (At1g13600) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172817.21e-127basic leucine-zipper 58
SwissprotQ9FMC22e-36BZP43_ARATH; Basic leucine zipper 43
TrEMBLQ9LMY81e-127Q9LMY8_ARATH; Basic leucine-zipper 58
STRINGAT1G13600.11e-127(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13600.11e-110basic leucine-zipper 58