PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3375s0006.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 573aa    MW: 64242.9 Da    PI: 5.0483
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3375s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.74.8e-49131392128
                  NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                          +pGfrFhPtdeelvv+yLk+k+ g+kl++ ++i  vd+ykv+P++Lp  +++k+++++w+fF++r++ky++  r++r t +gyWkatgkd
  Cagra.3375s0006.1.p  13 APGFRFHPTDEELVVYYLKRKICGRKLRI-NAIGVVDVYKVDPSELPglSMLKTGDRQWFFFTPRNRKYPNAARSSRGTVTGYWKATGKD 101
                          69***************************.89***************644888999********************************** PP

                  NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          + +   +++ vglkktLvfy+grap+ge+tdWvmhey++
  Cagra.3375s0006.1.p 102 RVIEY-NSRSVGLKKTLVFYRGRAPNGERTDWVMHEYTM 139
                          ***99.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.83312162IPR003441NAC domain
SuperFamilySSF1019417.06E-5513162IPR003441NAC domain
PfamPF023655.5E-2614138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MADSCFKAGK FSAPGFRFHP TDEELVVYYL KRKICGRKLR INAIGVVDVY KVDPSELPGL  60
SMLKTGDRQW FFFTPRNRKY PNAARSSRGT VTGYWKATGK DRVIEYNSRS VGLKKTLVFY  120
RGRAPNGERT DWVMHEYTMD EEELGRCKNA KEYFALYKLY KKSGAGPKNG EQYGAPFQEE  180
EWVDSDYEEA DNVAVPDNPV VHYENTRRMD DTKCCNPVSV RLEDIEKLLN EIPEAPEVTT  240
RQFNGFAGVP QGNSVEEIQS TLLNGSSGEF IDPRKTGVFL PNAQPYNRNS SFQSRLKSAN  300
SFEATSGMTP LLDFEKEDYI EMDDLLIPEL GASSAEKSGE FLNNGELGDI NEFDQLFHDI  360
SMSLDVDPVF QGTSTDMSSL SNFANNTSDQ KQQFLYPQLD QTLEYQQNNF MHPSTTLNHF  420
TDNMWFQDGR AALYDQQPQS SSGVFTSHST GVMPPESMNP TMSVNAQNTE GQNGGKTTSQ  480
FSSALWELLE SIPSTPASAC EGPLNQTFVR MSSFSRIRFN GTTSVTSRKV TVAKKRISNR  540
GFLLLSIMGA LCAIFWMYIA TVGVMERPVV LS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-441413917140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcriptional activator that promotes leaf senescence by up-regulating senescence-associated genes in response to developmental and stress-induced senescence signals. Functions in salt and oxidative stress-responsive signaling pathways. Binds to the promoter of NAC029/NAP and NAC059/ORS1 genes (PubMed:23926065). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:23926065}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00178DAPTransfer from AT1G34180Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.3375s0006.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold, salt, drought stress and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934930.0AB493493.1 Arabidopsis thaliana At1g34180 mRNA for hypothetical protein, partial cds, clone: RAAt1g34180.
GenBankBT0303440.0BT030344.1 Arabidopsis thaliana At1g34180 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006307120.10.0NAC domain-containing protein 16
SwissprotA4FVP60.0NAC16_ARATH; NAC domain-containing protein 16
TrEMBLR0IRU70.0R0IRU7_9BRAS; Uncharacterized protein
STRINGCagra.3375s0006.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34180.10.0NAC domain containing protein 16
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]