PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3166s0035.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GeBP
Protein Properties Length: 540aa    MW: 60803.6 Da    PI: 9.1622
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3166s0035.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573120.77.3e-3874170298
               DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifel 91 
                          +++r+w+eeDe+++L+Gl+d++aktg + + d+dafy+fv +si++kvsk+ql++Kir+LKkKf  +++k+++g++p+f++++d+++f++
  Cagra.3166s0035.1.p  74 MSNRIWNEEDELAILKGLVDYRAKTGFETKIDWDAFYRFVGGSIHVKVSKDQLSSKIRKLKKKFLLHMEKINQGNDPHFTRSSDSEAFGF 163
                          689*************************************************************************************** PP

               DUF573  92 skkiWgs 98 
                          s++iWg+
  Cagra.3166s0035.1.p 164 SMMIWGQ 170
                          *****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-2876169IPR007592Protein of unknown function DUF573
SMARTSM007241.2E-40323528IPR006634TRAM/LAG1/CLN8 homology domain
PROSITE profilePS509229.302323528IPR006634TRAM/LAG1/CLN8 homology domain
PfamPF037984.7E-13330520IPR006634TRAM/LAG1/CLN8 homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MATPTQLDFS SPVVDGGGDY SDDTSPSFSR RRKPPRKPAS KRAASETLTE EETKKKKKKK  60
VRNNNNNNKL ASPMSNRIWN EEDELAILKG LVDYRAKTGF ETKIDWDAFY RFVGGSIHVK  120
VSKDQLSSKI RKLKKKFLLH MEKINQGNDP HFTRSSDSEA FGFSMMIWGQ TDAENGGMDK  180
AHQSETQEEM FKEDEVVALI GNGTARSDFD DGNGTAGKEN DGNKDEDELC AVQDAFETMM  240
SQGLSDYQKK LHVKKLMNLG TEKRRELSNE WKALGVEERL RLRSQMSIDI GEISIPDLPL  300
FFSMFLTIYL IAYLIVFRNW KPQIRPEASS CLISIFHGTP AVFLATRAVF SSSSRSFSSA  360
NTAAQNTVLD FSVAYFLTDL VHYIVFNPSD VLFIGHHLAT LFVFLTCRFL VFHGACAILG  420
LLILAEVTSA CQNAWTLAGA RKDDPESRLA VKVYDLLSPP FYAFYSIVRG VLGPLFFGKM  480
VAFYARGGAH GVIPNWLWIS WALVVGTAIT VSILWIWNLW IDLFRQRKAS QLRQDKKIR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15359KKKKKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.3166s0035.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1175480.0AK117548.1 Arabidopsis thaliana At5g14280 mRNA for unknown protein, complete cds, clone: RAFL17-19-N04.
GenBankAL1638170.0AL163817.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F18O22 (ESSA project).
GenBankAY0756160.0AY075616.1 Arabidopsis thaliana AT5g14280/F18O22_70 mRNA sequence.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023637720.10.0GLABROUS1 enhancer-binding protein-like 2
TrEMBLD7M6220.0D7M622_ARALL; Predicted protein
STRINGCagra.3166s0035.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM187655
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14280.10.0DNA-binding storekeeper protein-related