PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.3125s0012.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 341aa    MW: 38660.4 Da    PI: 6.8697
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.3125s0012.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.61.1e-48141401128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                          l pGfrF+Ptd el+++yL++k++g++ ++  vi+ev+iyk+ePwdLp ++  ++e+ew++F+ r +ky++g++++rat+ gyWkatgk+
  Cagra.3125s0012.1.p  14 LFPGFRFSPTDVELISYYLRRKIDGDERSV-AVIAEVEIYKFEPWDLPeESKLKSENEWFYFCARGRKYPHGSQSRRATQLGYWKATGKE 102
                          579************************999.89***************433334678********************************* PP

                  NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++v+s ++++vg+k+tLvf+ grap+ge+t+W+mhey +
  Cagra.3125s0012.1.p 103 RSVKS-GNQVVGTKRTLVFHIGRAPRGERTEWIMHEYCI 140
                          *****.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-546155IPR003441NAC domain
PROSITE profilePS5100552.43714156IPR003441NAC domain
PfamPF023652.8E-2416139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MSKEAEMSIA VSALFPGFRF SPTDVELISY YLRRKIDGDE RSVAVIAEVE IYKFEPWDLP  60
EESKLKSENE WFYFCARGRK YPHGSQSRRA TQLGYWKATG KERSVKSGNQ VVGTKRTLVF  120
HIGRAPRGER TEWIMHEYCI HGAPQDALVV CRLRKNADFR ASSSQKQMEY GVVQDDGYVG  180
QRGGGSEKEE KSHSVYDSEL RISNGDIAES SNVVEDQGDT DDDCYAEILN DDIIKLDEEA  240
LKASQAFRPT NPTQQESILS EASSHRSKCG IKKESKDTNC YALFRIKNVP GTDSSWRFPN  300
PFHIKKDDSQ RLMKNVLATT VFLAILFSFF WTILIARNSS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-43413810138Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.3125s0012.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:17410378, ECO:0000269|PubMed:18363782, ECO:0000269|PubMed:19704528, ECO:0000269|PubMed:19704545}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0289340.0BT028934.1 Arabidopsis thaliana At2g27300 mRNA, complete cds.
GenBankDQ0565440.0DQ056544.1 Arabidopsis thaliana no apical meristem family protein (At2g27300) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294532.10.0NAC domain-containing protein 40
SwissprotQ9XIN70.0NAC40_ARATH; NAC domain-containing protein 40
TrEMBLR0HQ770.0R0HQ77_9BRAS; Uncharacterized protein
STRINGCagra.3125s0012.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM104532533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.10.0NTM1-like 8
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  2. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]