PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.27949s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 346aa    MW: 38026.8 Da    PI: 8.114
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.27949s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.13.6e-4911227128
                   NAM   7 FhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                           FhPtdeelvv+yLk+k+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++
  Cagra.27949s0001.1.p   1 FHPTDEELVVHYLKRKAASAPLPV-AIIAEVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLAS 88 
                           9***********************.88***************999999***************************************99 PP

                   NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                            ++++vg+kk Lvfy+g+ pkg k+dW+mheyrl
  Cagra.27949s0001.1.p  89 dGNQKVGVKKALVFYSGKPPKGIKSDWIMHEYRL 122
                           67788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-591156IPR003441NAC domain
PROSITE profilePS5100557.7841156IPR003441NAC domain
PfamPF023653.9E-241122IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
FHPTDEELVV HYLKRKAASA PLPVAIIAEV DLYKFDPWEL PAKASFGEQE WYFFSPRDRK  60
YPNGARPNRA ATSGYWKATG TDKPVLASDG NQKVGVKKAL VFYSGKPPKG IKSDWIMHEY  120
RLIENKLNNR PPGCDFGNKK NSLRLDDWVL CRIYKKNNAG RHVDNDKDHD MIDYIFRKIP  180
PSLSMAATAT GLHHHHHNVS RSMNFFPGKF SGGGYGIFSD GNTSLYDGGG MINNMGTDSV  240
DHDNNSEVVG LNHASSSGPM MMASLKRALP VPYWPVAEEE QDASPSKRFH GGGGGGDCSN  300
MSSTMMEETP PILMQQQGGG GGGVLGDGLF RTTPYQLPGL NWYPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-68116123170NO APICAL MERISTEM PROTEIN
1ut4_B4e-68116123170NO APICAL MERISTEM PROTEIN
1ut7_A4e-68116123170NO APICAL MERISTEM PROTEIN
1ut7_B4e-68116123170NO APICAL MERISTEM PROTEIN
3swm_A5e-68116126173NAC domain-containing protein 19
3swm_B5e-68116126173NAC domain-containing protein 19
3swm_C5e-68116126173NAC domain-containing protein 19
3swm_D5e-68116126173NAC domain-containing protein 19
3swp_A5e-68116126173NAC domain-containing protein 19
3swp_B5e-68116126173NAC domain-containing protein 19
3swp_C5e-68116126173NAC domain-containing protein 19
3swp_D5e-68116126173NAC domain-containing protein 19
4dul_A4e-68116123170NAC domain-containing protein 19
4dul_B4e-68116123170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.27949s0001.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0490710.0AB049071.1 Arabidopsis thaliana AtNAC2 mRNA, complete cds.
GenBankBT0040790.0BT004079.1 Arabidopsis thaliana clone RAFL15-22-L08 (R20756) putative jasmonic acid regulatory protein (At3g15510) mRNA, complete cds.
GenBankBT0050440.0BT005044.1 Arabidopsis thaliana clone U20756 putative jasmonic acid regulatory protein (At3g15510) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297968.10.0NAC transcription factor 56
SwissprotQ9LD440.0NAC56_ARATH; NAC transcription factor 56
TrEMBLR0G6260.0R0G626_9BRAS; Uncharacterized protein
STRINGCagra.27949s0001.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.10.0NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]