PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.2475s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 310aa    MW: 34400.7 Da    PI: 4.4129
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.2475s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.54.6e-4351041100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC+++Cv+apyfp ++p+kf +vhk+FGasnv+k+l++lp+++re++++sl+yeAear+rdP+yG+vg+i+ lqq l+++
  Cagra.2475s0001.1.p   5 PCAACKLLRRKCTQECVFAPYFPPTNPQKFICVHKVFGASNVTKILNDLPPDQREETVNSLFYEAEARIRDPIYGCVGLISFLQQYLKKV 94 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++l+++kee
  Cagra.2475s0001.1.p  95 QQDLVTAKEE 104
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381554.3E-1112307IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089127.2014105IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-415102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MASTPCAACK LLRRKCTQEC VFAPYFPPTN PQKFICVHKV FGASNVTKIL NDLPPDQREE  60
TVNSLFYEAE ARIRDPIYGC VGLISFLQQY LKKVQQDLVT AKEELVGYMG PDAVIPPPYL  120
PPLGNNPPPN FMMSMDGMPP GVIPHGEPLM IREPNLSQQH QPQDDQLQYI ASDAQRMAAM  180
IMDRGDQQGI FSGYGIDNNG SVTATGYNQM DVNHDHGAGG SLSGPSLALG NFADPYQMGQ  240
ETEHGHINHD QLQTQLMLQP PLQEGQEQTE EAQFLMQPMG QENLHEEEGE EELEPPVKWR  300
KSESKEASY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0044820.0AC004482.3 Arabidopsis thaliana chromosome 2 clone F27L4 map CIC06C07, complete sequence.
GenBankAC0030400.0AC003040.3 Arabidopsis thaliana chromosome 2 clone F26B6 map CIC06C07, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankAB4738350.0AB473835.1 Arabidopsis thaliana ASL2 mRNA for ASYMMETRIC LEAVES2-like 2 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296515.10.0hypothetical protein CARUB_v10025704mg
SwissprotO648360.0LBD10_ARATH; LOB domain-containing protein 10
TrEMBLR0HZB70.0R0HZB7_9BRAS; Uncharacterized protein
STRINGscaffold_400352.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149081720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23660.21e-156LOB domain-containing protein 10