PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.2412s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NF-YB
Protein Properties Length: 221aa    MW: 25299.7 Da    PI: 6.2309
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.2412s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.23.6e-5637132297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          +eqdrflPianv+rimkkvlP+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfedyv+plkvyl kyr
  Cagra.2412s0002.1.p  37 KEQDRFLPIANVGRIMKKVLPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFEDYVAPLKVYLCKYR 126
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          ++egek
  Cagra.2412s0002.1.p 127 DTEGEK 132
                          ***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.8E-5530170IPR009072Histone-fold
SuperFamilySSF471135.59E-4239168IPR009072Histone-fold
PfamPF008084.3E-2842106IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.5E-187088No hitNo description
PROSITE patternPS0068507389IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.5E-1889107No hitNo description
PRINTSPR006152.5E-18108126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MTEESPEEDH GSPEIAETNP GSPSSKTNNN NNNNNNKEQD RFLPIANVGR IMKKVLPGNG  60
KISKDAKETV QECVSEFISF VTGEASDKCQ REKRKTINGD DIIWAITTLG FEDYVAPLKV  120
YLCKYRDTEG EKVNSPKQQQ QQQRQQQQQQ IQQQNHHNYN QFQEQDQNNN NMSCTSYISH  180
HHPSPFLPAD HQPFPNIAFS PKPLQKQFPQ QHDNIDSIHW *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4437127292Transcription factor HapC (Eurofung)
4g92_B2e-4437127292Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.2412s0002.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0070630.0AC007063.6 Arabidopsis thaliana chromosome 2 clone T10F5 map PR1, complete sequence.
GenBankBT0252760.0BT025276.1 Arabidopsis thaliana At2g13570 mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankDQ4464910.0DQ446491.1 Arabidopsis thaliana clone pENTR221-At2g13570 CCAAT-box binding transcription factor (At2g13570) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296803.11e-137nuclear transcription factor Y subunit B-7
SwissprotQ9SIT91e-133NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLR0G2Z81e-136R0G2Z8_9BRAS; Uncharacterized protein
STRINGCagra.2412s0002.1.p1e-163(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.11e-119nuclear factor Y, subunit B7
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]