PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.2350s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 259aa    MW: 28322.3 Da    PI: 5.6038
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.2350s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.11.3e-1091138552
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                          k e+r   NReA r++R++Kka+ + Le++v  L a N++L k+l++ 
  Cagra.2350s0050.1.p  91 KGEKRPLGNREAVRKYREKKKAKAASLEDEVSRLRAVNQQLVKRLQNQ 138
                          6799999***********************************999863 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.0E-1187154IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.86489155IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-1390155No hitNo description
PfamPF077161.9E-1491144IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.82E-791138No hitNo description
CDDcd146862.74E-1293146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MEDGELEFSN QEVFSSSEMG ELPPSNCSMD SFFDGLLMDT NAACTHTHTC NPTGPENTHT  60
HTCFHVHTKI LPDDSDEKVS TDDTAESCGK KGEKRPLGNR EAVRKYREKK KAKAASLEDE  120
VSRLRAVNQQ LVKRLQNQAT LEAEVSRLKC LLVDLRGRID GEIGSFPYQK PNIPSFSHMM  180
NPCNVQCDDE VYCPQNGFGG NTQEVASIND QGLSGCDFDQ LQCMANQNLG GNANGSFNNS  240
NASVSNKRKG GHRASRAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0001600.0BT000160.1 Arabidopsis thaliana putative protein (At4g35040) mRNA, complete cds.
GenBankAY0861530.0AY086153.1 Arabidopsis thaliana clone 21838 mRNA, complete sequence.
GenBankAY0723860.0AY072386.1 Arabidopsis thaliana putative protein (At4g35040) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284366.10.0hypothetical protein CARUB_v10005538mg
SwissprotQ8VY761e-178BZP19_ARATH; Basic leucine zipper 19
TrEMBLR0GK700.0R0GK70_9BRAS; Uncharacterized protein
STRINGAT4G35040.11e-176(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20362879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-166bZIP family protein