PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.2213s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 165aa    MW: 18639.3 Da    PI: 9.9712
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.2213s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1744.3e-54161421128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk
  Cagra.2213s0001.1.p  16 LPPGFRFHPTDEELVVHYLKKKATSVPLPV-SIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDK 104
                          79****************************.89***************9888999*********************************** PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++++ ++++vg+kk Lvfy g+ pkg ktdW+mheyrl
  Cagra.2213s0001.1.p 105 PIFTCNSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRL 142
                          ************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-617149IPR003441NAC domain
PROSITE profilePS5100555.316165IPR003441NAC domain
PfamPF023652.2E-2817142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MENMGDSSIG PGHPHLPPGF RFHPTDEELV VHYLKKKATS VPLPVSIIAE IDLYKFDPWE  60
LPSKASFGEH EWYFFSPRDR KYPNGVRPNR AATSGYWKAT GTDKPIFTCN SHKVGVKKAL  120
VFYGGKPPKG IKTDWIMHEY RLTDGNLSNT AKPPDIATTR KNSLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-651615520158NAC domain-containing protein 19
3swm_B4e-651615520158NAC domain-containing protein 19
3swm_C4e-651615520158NAC domain-containing protein 19
3swm_D4e-651615520158NAC domain-containing protein 19
3swp_A4e-651615520158NAC domain-containing protein 19
3swp_B4e-651615520158NAC domain-containing protein 19
3swp_C4e-651615520158NAC domain-containing protein 19
3swp_D4e-651615520158NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.2213s0001.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0878390.0AY087839.1 Arabidopsis thaliana clone 38858 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006300981.11e-121NAC transcription factor 25
SwissprotQ8GY421e-117NAC25_ARATH; NAC transcription factor 25
TrEMBLR0HVK81e-119R0HVK8_9BRAS; Uncharacterized protein
STRINGXP_006300981.11e-120(Capsella rubella)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-120NAC domain containing protein 25