PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.2098s0066.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 481aa    MW: 55711.7 Da    PI: 5.5428
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.2098s0066.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.91.1e-5461331128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                          lppGfrFhPtdeel+++yLk+k++g ++el evi+evd+yk+ePwdLp k  + ++++ewyfFs+rd+ky++g+r+nratk gyWkatgk
  Cagra.2098s0066.1.p   6 LPPGFRFHPTDEELITYYLKRKINGLEIEL-EVIAEVDLYKCEPWDLPgKsLLPSKDQEWYFFSPRDRKYPNGSRTNRATKGGYWKATGK 94 
                          79****************************.99***************6345667999******************************** PP

                  NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          d++v   +++++g+kktLv+y+grap+g +t Wvmheyrl
  Cagra.2098s0066.1.p  95 DRRVSW-RDRAIGTKKTLVYYRGRAPHGIRTGWVMHEYRL 133
                          *****9.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-634157IPR003441NAC domain
PROSITE profilePS5100561.0256157IPR003441NAC domain
PfamPF023657.1E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090602Biological Processsieve element enucleation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI TYYLKRKING LEIELEVIAE VDLYKCEPWD LPGKSLLPSK  60
DQEWYFFSPR DRKYPNGSRT NRATKGGYWK ATGKDRRVSW RDRAIGTKKT LVYYRGRAPH  120
GIRTGWVMHE YRLDETECEP SAYGMQDAYA LCRVFKKIVI EAKPRDQHRS YVHAMPNVSG  180
NGSSSFDNCS DLEISSATHQ VQNTFQPRFG NERFNSNAIS NEDWSQFYGS SYRPFPTPYK  240
VNTEIECSML RHNVSLPPLR VENSAVNDCD FFTSMTHNNV HGVFDDFTFV ASNSNHYNSV  300
GDQVIHVGNY DDQLMTSNHH LNQAGYLEEQ KIIPSLDDTD HQNLGFHGNN TNEDHIDIDD  360
FFSFDIYNEE NVNRIEDNDE QLNTNETLDS SGFEVVEEET RFNNQMLIST YQTTKIQYHQ  420
VVPSHTLKVH VNHNNVEERT LFIEEDKDSW LQRAEKITKT KLTLCSLMAQ QYYKCLAIFF  480
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-55115712165NO APICAL MERISTEM PROTEIN
1ut4_B3e-55115712165NO APICAL MERISTEM PROTEIN
1ut7_A3e-55115712165NO APICAL MERISTEM PROTEIN
1ut7_B3e-55115712165NO APICAL MERISTEM PROTEIN
3swm_A3e-55115715168NAC domain-containing protein 19
3swm_B3e-55115715168NAC domain-containing protein 19
3swm_C3e-55115715168NAC domain-containing protein 19
3swm_D3e-55115715168NAC domain-containing protein 19
3swp_A3e-55115715168NAC domain-containing protein 19
3swp_B3e-55115715168NAC domain-containing protein 19
3swp_C3e-55115715168NAC domain-containing protein 19
3swp_D3e-55115715168NAC domain-containing protein 19
4dul_A3e-55115712165NAC domain-containing protein 19
4dul_B3e-55115712165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00329DAPTransfer from AT3G03200Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.2098s0066.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0304610.0BT030461.1 Arabidopsis thaliana At3g03200 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297561.10.0NAC domain-containing protein 45
SwissprotA4VCM00.0NAC45_ARATH; NAC domain-containing protein 45
TrEMBLR0HL740.0R0HL74_9BRAS; Uncharacterized protein
STRINGCagra.2098s0066.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44111852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03200.10.0NAC domain containing protein 45
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]