PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.2026s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family NAC
Protein Properties Length: 368aa    MW: 41864.6 Da    PI: 7.783
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.2026s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.88.5e-53101401128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeel+ +yL+kkv++++++l ++i++vdiyk++PwdLp+k+  +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk
  Cagra.2026s0001.1.p  10 LPPGFRFHPTDEELILHYLRKKVSSSPVPL-SIIADVDIYKSDPWDLPAKAPFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDK 98 
                          79****************************.89***************988899************************************ PP

                  NAM  91 evlsk....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           + ++     +e++g+kk Lvfykg+ pkg+kt+W+mheyrl
  Cagra.2026s0001.1.p  99 LIAVAngegFHENIGIKKALVFYKGKPPKGVKTNWIMHEYRL 140
                          ***9855444455***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-627184IPR003441NAC domain
PROSITE profilePS5100560.07110184IPR003441NAC domain
PfamPF023654.6E-2811140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MISKDPRSSL PPGFRFHPTD EELILHYLRK KVSSSPVPLS IIADVDIYKS DPWDLPAKAP  60
FGEKEWYFFS PRDRKYPNGA RPNRAAASGY WKATGTDKLI AVANGEGFHE NIGIKKALVF  120
YKGKPPKGVK TNWIMHEYRL AESFSPKRAN SSSSEVNNFG DRNLKSKEYS MRLDDWVLCR  180
IYKKSHASLS SSDVPSVTSN QEHEEKHSEP YVDRETFLPN LQQQNDQPLK RQKSSCSFSN  240
LLDATDLTFL TNFLNETPDI RTDDQSDFSF TIGNFSNPDT YGNHYLDQKL PRLSSPASET  300
SGIGNKRERS LDFAEETMNN TSKKTIMMNT YSYNNSVDHL DHGMIQQSSF LNQELLMSSS  360
HLQYQGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-71918816169NO APICAL MERISTEM PROTEIN
1ut4_B6e-71918816169NO APICAL MERISTEM PROTEIN
1ut7_A6e-71918816169NO APICAL MERISTEM PROTEIN
1ut7_B6e-71918816169NO APICAL MERISTEM PROTEIN
3swm_A6e-71918819172NAC domain-containing protein 19
3swm_B6e-71918819172NAC domain-containing protein 19
3swm_C6e-71918819172NAC domain-containing protein 19
3swm_D6e-71918819172NAC domain-containing protein 19
3swp_A6e-71918819172NAC domain-containing protein 19
3swp_B6e-71918819172NAC domain-containing protein 19
3swp_C6e-71918819172NAC domain-containing protein 19
3swp_D6e-71918819172NAC domain-containing protein 19
4dul_A6e-71918816169NAC domain-containing protein 19
4dul_B6e-71918816169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.2026s0001.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2274170.0AK227417.1 Arabidopsis thaliana mRNA for NAM-like protein, complete cds, clone: RAFL14-07-D22.
GenBankBT0059850.0BT005985.1 Arabidopsis thaliana At3g04070 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297959.10.0NAC transcription factor 47
SwissprotQ84TD60.0NAC47_ARATH; NAC transcription factor 47
TrEMBLR0G5M70.0R0G5M7_9BRAS; Uncharacterized protein
STRINGCagra.2026s0001.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77232540
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.10.0NAC domain containing protein 47
Publications ? help Back to Top
  1. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]